TkA06G021270 | RubberDandelionOmics

Gene overview

TkA06G021270

Reference: TK1151 Chr: Chr06 Coordinates: 5797553-5800243 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2129 bp · TkA06G021270|TK1151|cDNA

AAAAAAATAAAAACTTTTTCGTCGGTATAAATAAACCTCCGTTTCAACTTTCACCGGCAACGAGGGACGAAAATGGTTCAGTTTCACGAGAATATAATCGCCGATCTCCTCGAAGAACCCAGCGCCGGCGGCGGCCTAGTCGTTCTCTCTTCCGGACTTGCGCTCCACAAACTTATCGCCGGTTTCCTCCACCTGCACGACACTTACGAAGGCACTCTTCTCATCCTCTCTGCATCCCCTTCCCAGAAGCACTCCATCCT...

CDS

Download CDS FASTA

1491 bp · TkA06G021270|TK1151|CDS

ATGGTTCAGTTTCACGAGAATATAATCGCCGATCTCCTCGAAGAACCCAGCGCCGGCGGCGGCCTAGTCGTTCTCTCTTCCGGACTTGCGCTCCACAAACTTATCGCCGGTTTCCTCCACCTGCACGACACTTACGAAGGCACTCTTCTCATCCTCTCTGCATCCCCTTCCCAGAAGCACTCCATCCTCACCTCCCTAAACCCTAACCCTAACAACGAAAGCACCAAATCGCCGTCCGAGATCACTTCTGACCTCCCCGC...

Protein

Download Protein FASTA

496 aa · TkA06G021270|TK1151|PROTEIN

MVQFHENIIADLLEEPSAGGGLVVLSSGLALHKLIAGFLHLHDTYEGTLLILSASPSQKHSILTSLNPNPNNESTKSPSEITSDLPAHQRLSLYSSGNAFFITSRILIVDLLTRRLPTSTVAGIILLNAHSLSETCTEAFIVRILRSSNKNLYVRAFSDKPHAMVSGFAKAERTLKCLYLRKLHLWPRFQVYVSEELERDPPEVVDIRVPMSAYMVGIQKAVIEVMDACLKEMRKTNKVDVEDLTVENGLFKSFDEIVRR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G021270`
TK1151 ID	TkA06G021270
OH-1004 ID	LXL04_026211
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 96.573 / OH-1004 50.688 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G021270

Location Chr06:5797553-5800243 (-)

Description Similar to UVH1: DNA repair endonuclease UVH1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g41150`	Seems to be involved in nucleotide excision repair (NER) of damaged DNA (dark repair mechanism).	AtRAD1, a plant homologue of human and yeast nucleotide excision repair endonucleases, is involved in dark repair of UV damages and recombination.2000 · DOI: 10.1046/j.1365-313x.2000.00694.x Repair of UV damage in plants by nucleotide excision repair: Arabidopsis UVH1 DNA repair gene is a homolog of Saccharomyces cerevisiae Rad1.2000 · DOI: 10.1046/j.1365-313x.2000.00707.x The Arabidopsis UVH1 gene is a homolog of the yeast repair endonuclease RAD1.2000 · DOI: 10.1104/pp.124.2.579 Repair of damaged DNA by Arabidopsis cell extract.2002 · DOI: 10.1105/tpc.010258 Detection of Arabidopsis thaliana AtRAD1 cDNA variants and assessment of function by expression in a yeast rad1 mutant.2002 · DOI: 10.1016/s0378-1119(02)00869-7 Role of the AtRad1p endonuclease in homologous recombination in plants.2002 · DOI: 10.1093/embo-reports/kvf211

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026211 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000712 resolution of meiotic recombination intermediates Biological Process

GO:0000720 pyrimidine dimer repair by nucleotide-excision repair Biological Process

GO:0000723 telomere maintenance Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0000736 double-strand break repair via single-strand annealing, removal of nonhomologous ends Biological Process

GO:0006281 DNA repair Biological Process

GO:0006289 nucleotide-excision repair Biological Process

GO:0006303 double-strand break repair via nonhomologous end joining Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007131 reciprocal meiotic recombination Biological Process

GO:0009314 response to radiation Biological Process

GO:0009411 response to UV Biological Process

KEGG gene cross-reference

ath:AT5G41150

maj:MAA_03851

mmu:50505

spo:2538760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.933

Rank 1 · TkA06G021270 · TK1151

Cytoplasm0.161

Rank 2 · TkA06G021270 · TK1151

Mitochondrion0.025

Rank 3 · TkA06G021270 · TK1151

Cell membrane0.011

Rank 4 · TkA06G021270 · TK1151

Golgi apparatus0.007

Rank 5 · TkA06G021270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07743HSCB_C228-243 aa

PF07743HSCB_C260-307 aa

PF00619CARD266-291 aa

PF07743HSCB_C379-417 aa

PF10104Brr6_like_C_C388-456 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G021270	`PF07743`	HSCB_C	228	243	7.1	7.8
TkA06G021270	`PF07743`	HSCB_C	260	307	7.1	7.8
TkA06G021270	`PF00619`	CARD	266	291	0.11	13.3
TkA06G021270	`PF07743`	HSCB_C	379	417	7.1	7.8
TkA06G021270	`PF10104`	Brr6_like_C_C	388	456	1.9	9.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LKI5`	Arabidopsis thaliana	sp\|Q9LKI5\|XPF_ARATH DNA repair endonuclease UVH1	62.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card