TkA06G020790 | RubberDandelionOmics

Gene overview

TkA06G020790

Reference: TK1151 Chr: Chr06 Coordinates: 5672183-5673502 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

864 bp · TkA06G020790|TK1151|cDNA

GATCTTTAATATTGAAAACGTTTAAAGGACCATTCCACAATTCTACTGTAAGCTAGTCTCTCACTGTCTATCGGCAACGGCGAACGGGAAAGATGGGAACCTTACCGGTGGTCTACTCGCATCAGTTACTAAGCTCTAATCAAGTCGGTTCTCAGTTCAACAAGCGGAGAAATGCAACTAGTTTGTCAACAGTGTCCGCCGAAGTCCCGATTGAATCAACTTTCATCGGAAGCTGCAAGGTCCGACAGAGGTTGAGGAGG...

CDS

Download CDS FASTA

567 bp · TkA06G020790|TK1151|CDS

ATGGGAACCTTACCGGTGGTCTACTCGCATCAGTTACTAAGCTCTAATCAAGTCGGTTCTCAGTTCAACAAGCGGAGAAATGCAACTAGTTTGTCAACAGTGTCCGCCGAAGTCCCGATTGAATCAACTTTCATCGGAAGCTGCAAGGTCCGACAGAGGTTGAGGAGGTTATCTCCGTCCCCTTCAAATCAAAGATCATACACTAGCCAGCTCTGCAAGTCCCAACTCGTTCAAGATTTTGCCCCGGCAGCTTCTGCAGG...

Protein

Download Protein FASTA

188 aa · TkA06G020790|TK1151|PROTEIN

MGTLPVVYSHQLLSSNQVGSQFNKRRNATSLSTVSAEVPIESTFIGSCKVRQRLRRLSPSPSNQRSYTSQLCKSQLVQDFAPAASAGYAILLLGGGLFAYSKSGSKGSLFGGLTGAALMSVAYYLMQSSDTKEIGDALAFGASLLFAAVFGIRLAATRKAMPAGLLLGLSVAIMAVTFSAYLQDRTLM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G020790`
TK1151 ID	TkA06G020790
OH-1004 ID	LXL04_026220
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G020790

Location Chr06:5672183-5673502 (-)

Description Similar to FAX4: Protein FATTY ACID EXPORT 4, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g33265`	May be involved in free fatty acids export from the plastids.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026220 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006783 heme biosynthetic process Biological Process

GO:0006784 heme A biosynthetic process Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0015908 fatty acid transport Biological Process

GO:1905885 positive regulation of triglyceride transport Biological Process

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0031966 mitochondrial membrane Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0015245 fatty acid transmembrane transporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G33265

dme:Dmel_CG5532

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.975

Rank 1 · TkA06G020790 · TK1151

Mitochondrion0.026

Rank 2 · TkA06G020790 · TK1151

Nucleus0.013

Rank 3 · TkA06G020790 · TK1151

Cytoplasm0.012

Rank 4 · TkA06G020790 · TK1151

Cell membrane0.007

Rank 5 · TkA06G020790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12670DUF379280-149 aa

PF03647Tmemb_1486-176 aa

PF19053EccD86-179 aa

PF12670DUF3792144-177 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G020790	`PF12670`	DUF3792	80	149	0.27	12.1
TkA06G020790	`PF03647`	Tmemb_14	86	176	4.2e-18	66.5
TkA06G020790	`PF19053`	EccD	86	179	0.45	10.1
TkA06G020790	`PF12670`	DUF3792	144	177	0.27	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LPG1`	Arabidopsis thaliana	sp\|Q8LPG1\|FAX4_ARATH Protein FATTY ACID EXPORT 4, chloroplastic	56.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card