TkA06G019010 | RubberDandelionOmics

Gene overview

TkA06G019010

Reference: TK1151 Chr: Chr06 Coordinates: 5220369-5221619 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1164 bp · TkA06G019010|TK1151|cDNA

ATGAATAATACCAATGATGACGAGCATCAAGGCGGAGGGATGATGATGGTGGTGGAGAGGGAGCACATGTTTGATAAAGTGGTCACTCCGAGTGACGTAGGCAAGCTGAATCGACTCGTGATTCCGAAACAGCACGCCGAGAGGTATTTCCCCTTGGATTCCTCCACCAACGATAAGGGTCTCCTCCTCAATTTTGAAGATAGGAATGGAAAACCCTGGAGGTTTAGGTACTCCTACTGGAACAGCAGTCAAAGCTATGT...

CDS

Download CDS FASTA

1164 bp · TkA06G019010|TK1151|CDS

ATGAATAATACCAATGATGACGAGCATCAAGGCGGAGGGATGATGATGGTGGTGGAGAGGGAGCACATGTTTGATAAAGTGGTCACTCCGAGTGACGTAGGCAAGCTGAATCGACTCGTGATTCCGAAACAGCACGCCGAGAGGTATTTCCCCTTGGATTCCTCCACCAACGATAAGGGTCTCCTCCTCAATTTTGAAGATAGGAATGGAAAACCCTGGAGGTTTAGGTACTCCTACTGGAACAGCAGTCAAAGCTATGT...

Protein

Download Protein FASTA

387 aa · TkA06G019010|TK1151|PROTEIN

MNNTNDDEHQGGGMMMVVEREHMFDKVVTPSDVGKLNRLVIPKQHAERYFPLDSSTNDKGLLLNFEDRNGKPWRFRYSYWNSSQSYVMTKGWSRFVKDKKLDAGDIVSFQRGVGGSAKDRLFIDWRHRPDAPPPPYQLSSNLSFPLPHHQFFHNRNNNAGPPPQRTHSNLMLQSPNSYPPPSYRYGSSTPGGPYHNIGTGSVVNVNQGGSGSVIYFRSGVGGGGIPQQQHADMMQRSGHGVAIDPPALPPSPPGVVFESV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G019010`
TK1151 ID	TkA06G019010
OH-1004 ID	LXL04_026234
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.800
Protein coverage (%)	TK1151 95.607 / OH-1004 70.826 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G019010

Location Chr06:5220369-5221619 (+)

Description Similar to Os03g0120900: B3 domain-containing protein Os03g0120900

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46870`	Regulates lateral organ growth.	No verified direct reference in this release
`At1g01030`	Regulates lateral organ growth.	No verified direct reference in this release
`At3g61970`	Regulates lateral organ growth.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0120900`	B3 domain-containing protein Os03g0120900.	No verified direct reference in this release
`Os02g0683500`	B3 domain-containing protein Os02g0683500.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026234 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009908 flower development Biological Process

GO:0048366 leaf development Biological Process

GO:0048480 stigma development Biological Process

GO:1901371 regulation of leaf morphogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G01030

ath:AT2G46870

dosa:Os02g0683500

dosa:Os03g0120900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.946

Rank 1 · TkA06G019010 · TK1151

Cytoplasm0.113

Rank 2 · TkA06G019010 · TK1151

Endoplasmic reticulum0.047

Rank 3 · TkA06G019010 · TK1151

Cell membrane0.040

Rank 4 · TkA06G019010 · TK1151

Plastid0.012

Rank 5 · TkA06G019010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02362B324-111 aa

PF31239At5g26805_C26-109 aa

PF03754At2g31720-like56-108 aa

PF02362B3194-217 aa

PF04197Birna_RdRp_palm261-330 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G019010	`PF02362`	B3	24	111	2.4e-26	92.3
TkA06G019010	`PF31239`	At5g26805_C	26	109	0.00042	21.5
TkA06G019010	`PF03754`	At2g31720-like	56	108	0.00096	19.7
TkA06G019010	`PF02362`	B3	194	217	2.4e-26	92.3
TkA06G019010	`PF04197`	Birna_RdRp_palm	261	330	0.16	11.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82799`	Arabidopsis thaliana	sp\|O82799\|NGA1_ARATH B3 domain-containing transcription factor NGA1	49.600%	Swiss-Prot	Medium
`Q9MAN1`	Arabidopsis thaliana	sp\|Q9MAN1\|NGA3_ARATH B3 domain-containing transcription factor NGA3	48.700%	Swiss-Prot	Medium
`Q9M268`	Arabidopsis thaliana	sp\|Q9M268\|NGA2_ARATH B3 domain-containing transcription factor NGA2	73.600%	Swiss-Prot	Low
`Q8LMR9`	Oryza sativa subsp. japonica	sp\|Q8LMR9\|Y3209_ORYSJ B3 domain-containing protein Os03g0120900	50.200%	Swiss-Prot	Medium
`Q6EU30`	Oryza sativa subsp. japonica	sp\|Q6EU30\|Y2835_ORYSJ B3 domain-containing protein Os02g0683500	48.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card