TkA06G018980 | RubberDandelionOmics

Gene overview

TkA06G018980

Reference: TK1151 Chr: Chr06 Coordinates: 5206236-5214272 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1638 bp · TkA06G018980|TK1151|cDNA

TGTAACTTGGGCAATTAAATCTGCATTTGAACGGATGGAATTTGGAAGAAGGGAAGACGCGTTCGTTCTTCTTCGTCTTCATTTCGGCAGCTTCAAGAACAACACCCAGTTTCTCTCTTTTCCCGTTTGTTCCTTCTTTCTCCACCGCGACAGCCTAGAAGCTCCACCATTTTTCACCGTTCGTCTCCATCTCTCCACCGCGGTGTTCAACCTGGAGGCCAGCGAACGTCTTCGGGAGCAGCGAGTAACCTCCGGGAGGT...

CDS

Download CDS FASTA

636 bp · TkA06G018980|TK1151|CDS

ATGCATTGCCAGAGTGCTACCTCGATCGCTTATTCACCGTCGGAGATCTGTTTCACTAGCCGTTTTCAGCACTGTTCGACGACTTGGACTCCGGCGAAGCTTCTACTTCCCTTCGACGCTTCTGGCCACCTCTACTCTCTGATTTCGGCCGACGACACAGAAATGGATTTCAAAAGTTTGAGAAGATCAAAAACTCAAGTAGGCAAAGTAGGCAACCGGAAGAACTCATTGGAAAGATGCGGGAATGTCAAAGAGTTGAA...

Protein

Download Protein FASTA

211 aa · TkA06G018980|TK1151|PROTEIN

MHCQSATSIAYSPSEICFTSRFQHCSTTWTPAKLLLPFDASGHLYSLISADDTEMDFKSLRRSKTQVGKVGNRKNSLERCGNVKELNSYVALKKHNIENKRVDLFGGPVEGFEEDNGLLASSMTNQQLMDNCHHMMDETDQAIECSEKVVHETVTVGTETAATLKAQVASLLHDDVLDDVDTRCDIANSDRGRASSCWENNANEHVSKTTY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G018980`
TK1151 ID	TkA06G018980
OH-1004 ID	LXL04_026235
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	75.400
Protein coverage (%)	TK1151 86.730 / OH-1004 43.763 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G018980

Location Chr06:5206236-5214272 (+)

Description Similar to NPSN11: Novel plant SNARE 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g35190`	t-SNARE involved in diverse vesicle trafficking and membrane fusion processes, including cell plate formation.	No verified direct reference in this release
`At1g48240`	Vesicle trafficking protein that functions in the secretory pathway.	No verified direct reference in this release
`At3g17440`	Vesicle trafficking protein that functions in the secretory pathway.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026235 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0006906 vesicle fusion Biological Process

GO:0015031 protein transport Biological Process

GO:0042147 retrograde transport, endosome to Golgi Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005770 late endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT1G48240

ath:AT1G75850

ath:AT2G17790

ath:AT2G35190

ath:AT3G17440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.412

Rank 1 · TkA06G018980 · TK1151

Nucleus0.322

Rank 2 · TkA06G018980 · TK1151

Mitochondrion0.150

Rank 3 · TkA06G018980 · TK1151

Cell membrane0.148

Rank 4 · TkA06G018980 · TK1151

Endoplasmic reticulum0.104

Rank 5 · TkA06G018980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00348polyprenyl_synt43-104 aa

PF10669Phage_Gp23113-151 aa

PF11791Aconitase_B_N115-168 aa

PF27184YmdA131-167 aa

PF05957DUF883134-174 aa

PF00348polyprenyl_synt167-183 aa

PF27184YmdA180-206 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G018980	`PF00348`	polyprenyl_synt	43	104	0.01	15.8
TkA06G018980	`PF10669`	Phage_Gp23	113	151	0.19	12.8
TkA06G018980	`PF11791`	Aconitase_B_N	115	168	0.21	12.3
TkA06G018980	`PF27184`	YmdA	131	167	0.28	12.5
TkA06G018980	`PF05957`	DUF883	134	174	0.065	13.9
TkA06G018980	`PF00348`	polyprenyl_synt	167	183	0.01	15.8
TkA06G018980	`PF27184`	YmdA	180	206	0.28	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q944A9`	Arabidopsis thaliana	sp\|Q944A9\|NPS11_ARATH Novel plant SNARE 11	60.600%	Swiss-Prot	Low
`Q9LNH6`	Arabidopsis thaliana	sp\|Q9LNH6\|NPS12_ARATH Novel plant SNARE 12	42.000%	Swiss-Prot	Medium
`Q9LRP1`	Arabidopsis thaliana	sp\|Q9LRP1\|NPS13_ARATH Novel plant SNARE 13	44.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card