TkA06G018260 | RubberDandelionOmics

Gene overview

TkA06G018260

Reference: TK1151 Chr: Chr06 Coordinates: 4997340-5000240 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1885 bp · TkA06G018260|TK1151|cDNA

CCTCAGTTTAGCTTAAATAAATCTCTTGCAATCTTCTTCATTCCCACCTTCATCTCCTCTTCACTATGGGAAAGAAAGGGGGCGGTAGTTCTTGGTTCACAGCCGTCAAGAGAGCCTTTAGTCCAAACAAATCCAAGAACCAAGATCAAGATTTCGATCAAGAAGATGACAGGAAGAGGGAGAAGAGAAGATGGTTGTTTAGAAAATCATCAAATGTCGTACAACAACCGACTCAAATAGTAGTCAAGGATAATAATAAC...

CDS

Download CDS FASTA

1572 bp · TkA06G018260|TK1151|CDS

ATGGGAAAGAAAGGGGGCGGTAGTTCTTGGTTCACAGCCGTCAAGAGAGCCTTTAGTCCAAACAAATCCAAGAACCAAGATCAAGATTTCGATCAAGAAGATGACAGGAAGAGGGAGAAGAGAAGATGGTTGTTTAGAAAATCATCAAATGTCGTACAACAACCGACTCAAATAGTAGTCAAGGATAATAATAACGATGTTCCACAACCTAATCATGACCTCGCGGCAGAGGAGGAAAAGCGTGCGATTTTAATGGCGGC...

Protein

Download Protein FASTA

523 aa · TkA06G018260|TK1151|PROTEIN

MGKKGGGSSWFTAVKRAFSPNKSKNQDQDFDQEDDRKREKRRWLFRKSSNVVQQPTQIVVKDNNNDVPQPNHDLAAEEEKRAILMAAATIKAAEAAATTAHAAAEIIRLTSRPSPVSVKYHFAAILIQTSFRGYLARRALRALKGIVMLQAVIRGQNVRKQATMTLRCMQALLRVQSRLHDQRSRLSHDGGRKSSMAETPTFWDSKHLQDIRQRKSINSRDGSCIQDDSSDRPHTLEELDAILHSRKERDTSLATAFSQQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G018260`
TK1151 ID	TkA06G018260
OH-1004 ID	LXL04_026245
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G018260

Location Chr06:4997340-5000240 (-)

Description Similar to IQD14: Protein IQ-DOMAIN 14

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g01110`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At4g00820`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At4g10640`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At3g52290`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At3g49260`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	Calcium channels activated by hydrogen peroxide mediate abscisic acid signalling in guard cells.2000 · DOI: 10.1038/35021067 A defined range of guard cell calcium oscillation parameters encodes stomatal movements.2001 · DOI: 10.1038/35082575 CO(2) signaling in guard cells: calcium sensitivity response modulation, a Ca(2+)-independent phase, and CO(2) insensitivity of the gca2 mutant.2006 · DOI: 10.1073/pnas.0602225103 Combinatorial interactions of multiple cis-elements regulating the induction of the Arabidopsis XERO2 dehydrin gene by abscisic acid and cold.2008 · DOI: 10.1111/j.1365-313x.2007.03399.x Calcium elevation-dependent and attenuated resting calcium-dependent abscisic acid induction of stomatal closure and abscisic acid-induced enhancement of calcium sensitivities of S-type anion and inward-rectifying K channels in Arabidopsis guard cells.2009 · DOI: 10.1111/j.1365-313x.2009.03872.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026245 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016604 nuclear body Cellular Component

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT1G01110

ath:AT3G49380

ath:AT4G00820

ath:AT4G10640

ath:AT5G03040

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.411

Rank 1 · TkA06G018260 · TK1151

Cell membrane0.380

Rank 2 · TkA06G018260 · TK1151

Nucleus0.379

Rank 3 · TkA06G018260 · TK1151

Endoplasmic reticulum0.044

Rank 4 · TkA06G018260 · TK1151

Plastid0.035

Rank 5 · TkA06G018260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00612IQ41-47 aa

PF05857TraX82-156 aa

PF00612IQ123-141 aa

PF00612IQ144-161 aa

PF13178DUF4005335-359 aa

PF13178DUF4005373-482 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G018260	`PF00612`	IQ	41	47	3.8e-06	26.9
TkA06G018260	`PF05857`	TraX	82	156	0.46	11.0
TkA06G018260	`PF00612`	IQ	123	141	3.8e-06	26.9
TkA06G018260	`PF00612`	IQ	144	161	3.8e-06	26.9
TkA06G018260	`PF13178`	DUF4005	335	359	1.1e-25	90.9
TkA06G018260	`PF13178`	DUF4005	373	482	1.1e-25	90.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MAM4`	Arabidopsis thaliana	sp\|Q9MAM4\|IQD18_ARATH Protein IQ-DOMAIN 18	44.500%	Swiss-Prot	Medium
`F4JHN2`	Arabidopsis thaliana	sp\|F4JHN2\|IQD17_ARATH Protein IQ-DOMAIN 17	44.300%	Swiss-Prot	Medium
`Q7XA83`	Arabidopsis thaliana	sp\|Q7XA83\|IQD16_ARATH Protein IQ-DOMAIN 16	34.500%	Swiss-Prot	Medium
`Q9FT53`	Arabidopsis thaliana	sp\|Q9FT53\|IQD3_ARATH Protein IQ-DOMAIN 3	30.200%	Swiss-Prot	Medium
`Q9ASW3`	Arabidopsis thaliana	sp\|Q9ASW3\|IQD21_ARATH Protein IQ-DOMAIN 21	53.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card