TkA06G014920 | RubberDandelionOmics

Gene overview

TkA06G014920

Reference: TK1151 Chr: Chr06 Coordinates: 3990841-3992718 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1321 bp · TkA06G014920|TK1151|cDNA

ATGGATCCTGAAATGGCAAAGAAGATTAAGGAAACGGTGCTGGACGTGTTGAAAAATTCAGACATGGAGTCTACGACCGAATTCCAGGTTCGGAAATTAGCATCCGAGAAGCTCGGAGAGGATTTATCGGTGCCTGAACGGAAGAAGCTCGTGCGGAGTGTCGTCCAGACGTACCTTGAGGAACAACAGGCAAAAGCTACAACAACCCTAACATCTATGGATGATAAAAGAAGAGTGACTCTCACTGAATTCAAAGGAAA...

CDS

Download CDS FASTA

417 bp · TkA06G014920|TK1151|CDS

ATGGATCCTGAAATGGCAAAGAAGATTAAGGAAACGGTGCTGGACGTGTTGAAAAATTCAGACATGGAGTCTACGACCGAATTCCAGGTTCGGAAATTAGCATCCGAGAAGCTCGGAGAGGATTTATCGGTGCCTGAACGGAAGAAGCTCGTGCGGAGTGTCGTCCAGACGTACCTTGAGGAACAACAGGCAAAAGCTACAACAACCCTAACATCTATGGATGATAAAAGAAGAGTGACTCTCACTGAATTCAAAGGAAA...

Protein

Download Protein FASTA

138 aa · TkA06G014920|TK1151|PROTEIN

MDPEMAKKIKETVLDVLKNSDMESTTEFQVRKLASEKLGEDLSVPERKKLVRSVVQTYLEEQQAKATTTLTSMDDKRRVTLTEFKGKSLVSIREYYKKDGKELPSSKGISLTSEQWSTFSKNVPGIEQAIKKMEARFN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G014920`
TK1151 ID	TkA06G014920
OH-1004 ID	LXL04_026313
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	73.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G014920

Location Chr06:3990841-3992718 (+)

Description Similar to KELP: RNA polymerase II transcriptional coactivator KELP

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g10920`	General coactivator that functions cooperatively with TAFs and mediates functional interactions between upstream activators and the general transcriptional machinery.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026313 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009561 megagametogenesis Biological Process

GO:0045899 positive regulation of RNA polymerase II transcription preinitiation complex assembly Biological Process

GO:0060261 positive regulation of transcription initiation by RNA polymerase II Biological Process

GO:0005634 nucleus Cellular Component

GO:0005667 transcription regulator complex Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003690 double-stranded DNA binding Molecular Function

GO:0003697 single-stranded DNA binding Molecular Function

GO:0003713 transcription coactivator activity Molecular Function

GO:0046982 protein heterodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT4G10920

ath:AT5G09250

mcf:101926874

pon:100173565

spo:2542309

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.653

Rank 1 · TkA06G014920 · TK1151

Cytoplasm0.440

Rank 2 · TkA06G014920 · TK1151

Mitochondrion0.067

Rank 3 · TkA06G014920 · TK1151

Cell membrane0.043

Rank 4 · TkA06G014920 · TK1151

Endoplasmic reticulum0.039

Rank 5 · TkA06G014920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08766DEK_C7-59 aa

PF19064DUF57607-80 aa

PF16235DUF48949-68 aa

PF24810RBD_LARS111-68 aa

PF18080Gal_mutarotas_314-97 aa

PF02229PC474-121 aa

PF24810RBD_LARS189-114 aa

PF16235DUF4894102-136 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G014920	`PF08766`	DEK_C	7	59	1.9e-12	47.6
TkA06G014920	`PF19064`	DUF5760	7	80	0.11	13.4
TkA06G014920	`PF16235`	DUF4894	9	68	0.023	15.8
TkA06G014920	`PF24810`	RBD_LARS1	11	68	0.11	13.2
TkA06G014920	`PF18080`	Gal_mutarotas_3	14	97	0.016	15.9
TkA06G014920	`PF02229`	PC4	74	121	7.4e-22	77.3
TkA06G014920	`PF24810`	RBD_LARS1	89	114	0.11	13.2
TkA06G014920	`PF16235`	DUF4894	102	136	0.023	15.8
TkA06G014920	`PF08766`	DEK_C	128	137	1.9e-12	47.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65155`	Arabidopsis thaliana	sp\|O65155\|KELP_ARATH RNA polymerase II transcriptional coactivator KELP	52.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card