Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2015 bp · TkA06G013510|TK1151|cDNA
GAAAAGAAATAACCCTTTATAAGTTATTCAATTTTAAAGAGATATTGAAAATTTGATGTAGTCTGTTTAGTTATTGAAACAGTATGGACTTATAACAGGTTATCAAGAGTCAAGCCCACAACAACTCTGAGCCCTGCCTGAAAAGAGACAACCATACCCTTTTCCCGCCATTTCCTCTCTCATCTGTCACCAGTCACCGCCGATTATATATTTTCGGTTGAACTCCACCGGAGGGAAAAGCCAAGGTATCGATCTCGCCC...
924 bp · TkA06G013510|TK1151|CDS
ATGTATCGAGCACGAATTAATGTTCTCAAAATGGCATCATTTGATGACAATTCTCAATTCATGATTGCCATGTTGCGAGAATGTGGATTAGCACACAAGACAGTAATTTTCATATTGGACGAGTTTGACCTTTTTGCTCAGGGTAAACAAAGGTTACTATATAGCTTGTTAGATGCAATGCAGTCTGTAACTTCCCAAGCTGTTGTAATTGGTGTGAGTTGTCGATTGGATGCTGATCAGTTACTGGAAAAAAGAGTAAG...
Protein
Download Protein FASTA307 aa · TkA06G013510|TK1151|PROTEIN
MYRARINVLKMASFDDNSQFMIAMLRECGLAHKTVIFILDEFDLFAQGKQRLLYSLLDAMQSVTSQAVVIGVSCRLDADQLLEKRVRSRFSHRKLLFHPPSKDDIQRLLKHILQLPTDSTLPHDYVTKFNSKISSILADKRFMEVVDKLSDSDSTFSNLIRFLFCAVNLIDLKSGFITLENFKSALSTLHRQTKLDCLNDCSNLEFYIMVCMRRLEAKEQESYNFNSLMSEYNKVHDTFRLQNFDYYSRSVCLRAFEHLL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G013510 |
|---|---|
| TK1151 ID | TkA06G013510 |
| OH-1004 ID | LXL04_026320 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 97.068 / OH-1004 71.981Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G013510 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:3526096-3529964 (-) | ||||||||||||
| Description | Similar to ORC4: Origin of replication complex subunit 4 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006260 DNA replication Biological Process GO:0006270 DNA replication initiation Biological Process GO:0009744 response to sucrose Biological Process GO:0040038 polar body extrusion after meiotic divisions Biological Process GO:0051258 protein polymerization Biological Process GO:0000781 chromosome, telomeric region Cellular Component GO:0000808 origin recognition complex Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005664 nuclear origin of replication recognition complex Cellular Component GO:0005730 nucleolus Cellular Component GO:0005737 cytoplasm Cellular Component | ||||||||||||
| KEGG gene cross-reference | ath:AT2G01120 bta:529245 cge:100689043 dosa:Os01g0683400 hsa:5000 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00004AAA14-93 aaPF13401AAA_2216-71 aaPF13191AAA_1619-64 aaPF08578DUF176532-52 aaPF13191AAA_1679-164 aaPF13401AAA_2294-115 aaPF14629ORC4_C108-293 aaPF08578DUF1765129-170 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G013510 | PF00004 | AAA | 14 | 93 | 0.00084 | 20.5 |
| TkA06G013510 | PF13401 | AAA_22 | 16 | 71 | 0.15 | 13.1 |
| TkA06G013510 | PF13191 | AAA_16 | 19 | 64 | 0.0011 | 20.3 |
| TkA06G013510 | PF08578 | DUF1765 | 32 | 52 | 0.95 | 10.6 |
| TkA06G013510 | PF13191 | AAA_16 | 79 | 164 | 0.0011 | 20.3 |
| TkA06G013510 | PF13401 | AAA_22 | 94 | 115 | 0.15 | 13.1 |
| TkA06G013510 | PF14629 | ORC4_C | 108 | 293 | 3.2e-37 | 128.8 |
| TkA06G013510 | PF08578 | DUF1765 | 129 | 170 | 0.95 | 10.6 |
| TkA06G013510 | PF08578 | DUF1765 | 157 | 219 | 0.95 | 10.6 |
| TkA06G013510 | PF13401 | AAA_22 | 194 | 215 | 0.15 | 13.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.