RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G011700
Reference: TK1151 Chr: Chr06 Coordinates: 3067551-3070509 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1475 bp · TkA06G011700|TK1151|cDNA

TGCCATTTCCCTTTTTAGATCAGTCGCTCTTTGCGGTATATATATCTGCGCGCTTGTCCCAAAACACAAACCGCCTTCTTTGATTTGCTCAATACTCTCTCAATTTACTTTCTTAAAACCTTCATTCCGTTTGTTCTTCCATCTCAGCGATGGATTCATCGATTTTAGTTACTGGAGGTGCTGGATTTATAGGCACTCACACTGTTGTGCAACTTCTTAATCAAGGATTCAAGGTTACGATCATCGACAATCTTGATAAT...

CDS

Download CDS FASTA

1059 bp · TkA06G011700|TK1151|CDS

ATGGATTCATCGATTTTAGTTACTGGAGGTGCTGGATTTATAGGCACTCACACTGTTGTGCAACTTCTTAATCAAGGATTCAAGGTTACGATCATCGACAATCTTGATAATTCTGTCGAAGAAGCAGTTCATAGAGTCAGAGATTTAGTCGGTTCTGAGCTCTCACGTAATCTTCACTTTCATTTGGGTGATATCAGAAATCGGCAGGATTTGGAAAAGTTGTTTTCCCAAGCCAAGTTTGATGCTGTTATACACTTTGC...

Protein

Download Protein FASTA

352 aa · TkA06G011700|TK1151|PROTEIN

MDSSILVTGGAGFIGTHTVVQLLNQGFKVTIIDNLDNSVEEAVHRVRDLVGSELSRNLHFHLGDIRNRQDLEKLFSQAKFDAVIHFAGLKAVGESVAHPFRYFDNNLIGSITLYQVMAKYNCKKLVFSSSATVYGQPKKIPCVEDFELKAMNPYGRTKLFLEEIARDIQNADPEWKIILLRYFNPVGAHESGKLGEDPIGIPNNLMPYIQQVAVGRLPELNVYGHDYPTKDGSAIRDYIHVMDLADGHVAALKKLFTKQD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G011700
TK1151 IDTkA06G011700
OH-1004 IDLXL04_026470
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.700
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G011700
LocationChr06:3067551-3070509 (+)
DescriptionSimilar to UGE1: Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g63180 Catalyzes the interconversion between UDP-glucose and UDP-galactose and the interconversion between UDP-arabinose and UDP-xylose.
Distinct properties of the five UDP-D-glucose/UDP-D-galactose 4-epimerase isoforms of Arabidopsis thaliana.2006 · DOI: 10.1074/jbc.m512727200
UDP-glucose 4-epimerase isoforms UGE2 and UGE4 cooperate in providing UDP-galactose for cell wall biosynthesis and growth of Arabidopsis thaliana.2007 · DOI: 10.1105/tpc.106.049619
Bifunctional cytosolic UDP-glucose 4-epimerases catalyse the interconversion between UDP-D-xylose and UDP-L-arabinose in plants.2009 · DOI: 10.1042/bj20091025
At1g12780 Catalyzes the interconversion between UDP-glucose and UDP- galactose and the interconversion between UDP-arabinose and UDP-xylose.
Distinct properties of the five UDP-D-glucose/UDP-D-galactose 4-epimerase isoforms of Arabidopsis thaliana.2006 · DOI: 10.1074/jbc.m512727200
UDP-glucose 4-epimerase isoforms UGE2 and UGE4 cooperate in providing UDP-galactose for cell wall biosynthesis and growth of Arabidopsis thaliana.2007 · DOI: 10.1105/tpc.106.049619
Bifunctional cytosolic UDP-glucose 4-epimerases catalyse the interconversion between UDP-D-xylose and UDP-L-arabinose in plants.2009 · DOI: 10.1042/bj20091025

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_026470 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0005996 monosaccharide metabolic process Biological Process
GO:0006012 galactose metabolic process Biological Process
GO:0009555 pollen development Biological Process
GO:0033358 UDP-L-arabinose biosynthetic process Biological Process
GO:0045227 capsule polysaccharide biosynthetic process Biological Process
GO:0046369 galactose biosynthetic process Biological Process
GO:0071555 cell wall organization Biological Process
GO:0005829 cytosol Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0003978 UDP-glucose 4-epimerase activity Molecular Function
GO:0046983 protein dimerization activity Molecular Function
GO:0050373 UDP-arabinose 4-epimerase activity Molecular Function
KEGG gene cross-reference
ath:AT1G12780
ath:AT1G63180
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.634
Rank 1 · TkA06G011700 · TK1151
Nucleus0.263
Rank 2 · TkA06G011700 · TK1151
Mitochondrion0.134
Rank 3 · TkA06G011700 · TK1151
Cell membrane0.071
Rank 4 · TkA06G011700 · TK1151
Peroxisome0.069
Rank 5 · TkA06G011700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05368NmrA1-79 aa
PF04321RmlD_sub_bind4-167 aa
PF08659KR4-138 aa
PF01370Epimerase5-255 aa
PF02719Polysacc_synt_25-188 aa
PF00106adh_short5-113 aa
PF16363GDP_Man_Dehyd6-331 aa
PF010733Beta_HSD6-159 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G011700PF05368NmrA1790.007516.6
TkA06G011700PF04321RmlD_sub_bind41677.4e-1039.1
TkA06G011700PF08659KR41383.7e-0627.7
TkA06G011700PF01370Epimerase52553.1e-55187.9
TkA06G011700PF02719Polysacc_synt_251882.3e-1763.9
TkA06G011700PF00106adh_short51131.6e-0835.0
TkA06G011700PF16363GDP_Man_Dehyd63312.2e-65222.0
TkA06G011700PF010733Beta_HSD61597.5e-1452.1
TkA06G011700PF07993NAD_binding_471664e-0523.6
TkA06G011700PF13460NAD_binding_1091774.3e-0627.4
TkA06G011700PF13439Glyco_transf_49920.2412.1
TkA06G011700PF027373HCDH_N10580.002818.3
TkA06G011700PF13847Methyltransf_3110940.002918.1
TkA06G011700PF03721UDPG_MGDP_dh_N10600.02515.0
TkA06G011700PF03447NAD_binding_310970.2612.7
TkA06G011700PF13561adh_short_C214900.0314.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8LDN8Arabidopsis thalianasp|Q8LDN8|UGE3_ARATH Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 382.300%Swiss-ProtHigh
Q42605Arabidopsis thalianasp|Q42605|UGE1_ARATH Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 181.000%Swiss-ProtHigh

JBrowse

View in Genome Browser