Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1059 bp · LXL04_026470|LXL04_026470|OH1004|cDNA
ATGGATTCATCGATTTTAGTTACTGGAGGTGCTGGATTTATAGGCACTCACACTGTTGTGCAACTTCTTAATCAAGGATTCAAGGTTACGATCATCGACAATCTTGATAATTCTGTCGAAGAAGCAGTTCATAGAGTCAGAGATTTAGTCGGTTCTGAGCTCTCACGTAATCTTCACTTTCATTTGGGTGATATCAGAAATCGGCAGGATTTGGAAAAGTTGTTTTCCCAAGCCAAGTTTGATGCTGTTATACACTTTGC...
1059 bp · LXL04_026470|LXL04_026470|OH1004|CDS
ATGGATTCATCGATTTTAGTTACTGGAGGTGCTGGATTTATAGGCACTCACACTGTTGTGCAACTTCTTAATCAAGGATTCAAGGTTACGATCATCGACAATCTTGATAATTCTGTCGAAGAAGCAGTTCATAGAGTCAGAGATTTAGTCGGTTCTGAGCTCTCACGTAATCTTCACTTTCATTTGGGTGATATCAGAAATCGGCAGGATTTGGAAAAGTTGTTTTCCCAAGCCAAGTTTGATGCTGTTATACACTTTGC...
Protein
Download Protein FASTA352 aa · LXL04_026470|LXL04_026470|OH1004|PROTEIN
MDSSILVTGGAGFIGTHTVVQLLNQGFKVTIIDNLDNSVEEAVHRVRDLVGSELSRNLHFHLGDIRNRQDLEKLFSQAKFDAVIHFAGLKAVGESVAHPFRYFDNNLIGSITLYQVMAKYNCKKLVFSSSATVYGQPKKIPCVEDFELKAMNPYGRTKLFLEEIARDIQNADPEWKIILLRYFNPVGAHESGKLGEDPIGIPNNLMPYIQQVAVGRLPELNVYGHDYPTKDGSAIRDYIHVMDLADGHVAALKKLFTKQD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_026470 |
|---|---|
| TK1151 ID | TkA06G011700 |
| OH-1004 ID | LXL04_026470 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.700 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_026470 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:126881466-126884014 (+) | |||||||||
| Description | Similar to UGE1: Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0005996 monosaccharide metabolic process Biological Process GO:0006012 galactose metabolic process Biological Process GO:0009555 pollen development Biological Process GO:0033358 UDP-L-arabinose biosynthetic process Biological Process GO:0045227 capsule polysaccharide biosynthetic process Biological Process GO:0046369 galactose biosynthetic process Biological Process GO:0071555 cell wall organization Biological Process GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0003978 UDP-glucose 4-epimerase activity Molecular Function GO:0046983 protein dimerization activity Molecular Function GO:0050373 UDP-arabinose 4-epimerase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G12780 ath:AT1G63180 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04321.24RmlD_sub_bind4-167 aaPF08659.17KR4-138 aaPF01370.28Epimerase5-255 aaPF02719.22Polysacc_synt_25-188 aaPF00106.32adh_short5-113 aaPF16363.12GDP_Man_Dehyd6-331 aaPF01073.263Beta_HSD6-159 aaPF13460.13NAD_binding_109-177 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_026470 | PF04321.24 | RmlD_sub_bind | 4 | 167 | 7.4e-10 | 39.1 |
| LXL04_026470 | PF08659.17 | KR | 4 | 138 | 3.7e-06 | 27.7 |
| LXL04_026470 | PF01370.28 | Epimerase | 5 | 255 | 3.1e-55 | 187.9 |
| LXL04_026470 | PF02719.22 | Polysacc_synt_2 | 5 | 188 | 2.3e-17 | 63.9 |
| LXL04_026470 | PF00106.32 | adh_short | 5 | 113 | 1.6e-08 | 35.0 |
| LXL04_026470 | PF16363.12 | GDP_Man_Dehyd | 6 | 331 | 2.2e-65 | 222.0 |
| LXL04_026470 | PF01073.26 | 3Beta_HSD | 6 | 159 | 7.5e-14 | 52.1 |
| LXL04_026470 | PF13460.13 | NAD_binding_10 | 9 | 177 | 4.3e-06 | 27.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q8LDN8 | Arabidopsis thaliana | Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 3 | 82.029% | Swiss-Prot | strong database homology |
Q42605 | Arabidopsis thaliana | Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 | 80.692% | Swiss-Prot | strong database homology |