TkA06G011530 | RubberDandelionOmics

Gene overview

TkA06G011530

Reference: TK1151 Chr: Chr06 Coordinates: 3022683-3026364 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1319 bp · TkA06G011530|TK1151|cDNA

TAACTTGATGAAAAACATTTCGGGAGCATACGTTTTCAGTGTTGAATCTTCCATTATGCTTGATTGCCATATGGATTATCATCCTTTAAAGGCTACAGAATCATGCTTGGAGAAATTGATGTTGCAAAAACGGATATCTACATCTGACTTATCAACATAATTTGGAACTGCACCAGAATTGCTGTTGTTACTGCGGAAACCAAGGTCTTGGTTTAGAAATATGCAGGCAATTGGCAAACGAAGTTTTGGTGGTGTTGACT...

CDS

Download CDS FASTA

633 bp · TkA06G011530|TK1151|CDS

ATGATTAGTAGTAACGCTGACGAGGAGTACTTTGAGGGTGTAAGCCGTCTACTTAAGGAATATGGTCTAAAGGGATATGAAAATGAGAAACCATCGAAGAAAGTTGAAACACAAACATTTGAAGAAGCCAAGCAATGCTTAGAAACCAATTATTATGGAGCTAAATATGTCACACAAGCCTTGATGCCACTTCTTCGTAAATCCACATATCCAAGAATAGTCAACATCTCATCCAAAATGGGTCAACTACAACATGTTCA...

Protein

Download Protein FASTA

210 aa · TkA06G011530|TK1151|PROTEIN

MISSNADEEYFEGVSRLLKEYGLKGYENEKPSKKVETQTFEEAKQCLETNYYGAKYVTQALMPLLRKSTYPRIVNISSKMGQLQHVQDENARKILSDVDGLTEEMVDEVVSEYLKDAKDQKLLEKKGWSINVSGYIVSKAALNAYTRILAKKFPSFCANAVTPGFLATSFTSFKGTYTVEEGAMGPVRLALLPEGGPSGQYFFMMEQSTF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G011530`
TK1151 ID	TkA06G011530
OH-1004 ID	LXL04_026467
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 94.286 / OH-1004 13.769 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G011530

Location Chr06:3022683-3026364 (+)

Description Similar to SALR: Salutaridine reductase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g61220`	Aldehyde reductase that catalyzes the reduction of the aldehyde carbonyl groups on saturated and alpha,beta-unsaturated aldehydes with more than 5 carbons.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026467 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009820 alkaloid metabolic process Biological Process

GO:0016104 triterpenoid biosynthetic process Biological Process

GO:0016135 saponin biosynthetic process Biological Process

GO:0016020 membrane Cellular Component

GO:0016491 oxidoreductase activity Molecular Function

GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Molecular Function

GO:0047037 salutaridine reductase (NADPH) activity Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.656

Rank 1 · TkA06G011530 · TK1151

Nucleus0.240

Rank 2 · TkA06G011530 · TK1151

Peroxisome0.133

Rank 3 · TkA06G011530 · TK1151

Mitochondrion0.106

Rank 4 · TkA06G011530 · TK1151

Endoplasmic reticulum0.069

Rank 5 · TkA06G011530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14528LAGLIDADG_34-34 aa

PF26340DNA-SBD_ScoMcrA12-26 aa

PF23750RsgI_M30-37 aa

PF13561adh_short_C231-82 aa

PF00106adh_short32-84 aa

PF08678Rsbr_N54-113 aa

PF18043T4_Rnl2_C66-128 aa

PF14842FliG_N73-97 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G011530	`PF14528`	LAGLIDADG_3	4	34	0.13	13.2
TkA06G011530	`PF26340`	DNA-SBD_ScoMcrA	12	26	0.091	13.1
TkA06G011530	`PF23750`	RsgI_M	30	37	0.0019	19.5
TkA06G011530	`PF13561`	adh_short_C2	31	82	2.6e-08	34.4
TkA06G011530	`PF00106`	adh_short	32	84	6.6e-10	39.5
TkA06G011530	`PF08678`	Rsbr_N	54	113	0.14	13.0
TkA06G011530	`PF18043`	T4_Rnl2_C	66	128	0.13	13.3
TkA06G011530	`PF14842`	FliG_N	73	97	0.13	13.6
TkA06G011530	`PF23750`	RsgI_M	88	134	0.0019	19.5
TkA06G011530	`PF26340`	DNA-SBD_ScoMcrA	89	128	0.091	13.1
TkA06G011530	`PF14842`	FliG_N	97	127	0.13	13.6
TkA06G011530	`PF00106`	adh_short	130	171	6.6e-10	39.5
TkA06G011530	`PF13561`	adh_short_C2	133	172	2.6e-08	34.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2E2`	Arabidopsis thaliana	sp\|Q9M2E2\|SDR1_ARATH (+)-neomenthol dehydrogenase	50.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card