LXL04_026467 | RubberDandelionOmics

Gene overview

LXL04_026467

Reference: OH-1004 Chr: Chr05 Coordinates: 126816208-126833503 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4317 bp · LXL04_026467|LXL04_026467|OH1004|cDNA

ATGGTTTGTAGTTGGGTGAATTCGTGTCCTGCTCATGTTGGGATGAATTTGGGTTGGCGAGTTTGGAGCGGATCTCGGATCGAACCCGCGCCTGGTAGAGCTGTTTCTCTTGATCCAGAAGCCGTTTTTCCTTCTCCCTGGCTTGCTTTTCGTGGAGGCGCTTCCATTGCCATTTGTTCAGGCCGCCAGGGAACGTCCGTGGGCCGCCGCCCATGTGGCGGAGGAAGAATTGCTGTTGTTACTGGCGGAAACCAAGGTCT...

CDS

Download CDS FASTA

4317 bp · LXL04_026467|LXL04_026467|OH1004|CDS

ATGGTTTGTAGTTGGGTGAATTCGTGTCCTGCTCATGTTGGGATGAATTTGGGTTGGCGAGTTTGGAGCGGATCTCGGATCGAACCCGCGCCTGGTAGAGCTGTTTCTCTTGATCCAGAAGCCGTTTTTCCTTCTCCCTGGCTTGCTTTTCGTGGAGGCGCTTCCATTGCCATTTGTTCAGGCCGCCAGGGAACGTCCGTGGGCCGCCGCCCATGTGGCGGAGGAAGAATTGCTGTTGTTACTGGCGGAAACCAAGGTCT...

Protein

Download Protein FASTA

1438 aa · LXL04_026467|LXL04_026467|OH1004|PROTEIN

MVCSWVNSCPAHVGMNLGWRVWSGSRIEPAPGRAVSLDPEAVFPSPWLAFRGGASIAICSGRQGTSVGRRPCGGGRIAVVTGGNQGLGLEICRQLANEVLVVLTARDEKKGINAVAKLHYSGYPDVVFHQLDVTDPTSIASLAFFIELRFRKLDILVNNAGMISSNADEEYFEGVSRLLKEYGLKGYENEKPSKKVETQTFEEAKQCLETNYYGAKYVTQALMPLLRKSTYPRIVNISSKMGQLQHVQDENARKILSDVD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026467`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026467

Location Chr05:126816208-126833503 (+)

Description Similar to SALR: Salutaridine reductase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g61220`	Aldehyde reductase that catalyzes the reduction of the aldehyde carbonyl groups on saturated and alpha,beta-unsaturated aldehydes with more than 5 carbons.	No verified direct reference in this release
`At2g24190`	Aldehyde reductase that catalyzes the reduction of the aldehyde carbonyl groups on saturated and alpha,beta-unsaturated aldehydes with more than 5 carbons.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026467 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009820 alkaloid metabolic process Biological Process

GO:0016104 triterpenoid biosynthetic process Biological Process

GO:0016135 saponin biosynthetic process Biological Process

GO:0016020 membrane Cellular Component

GO:0016491 oxidoreductase activity Molecular Function

GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Molecular Function

GO:0047037 salutaridine reductase (NADPH) activity Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.565

Rank 1 · LXL04_026467 · OH-1004

Nucleus0.232

Rank 2 · LXL04_026467 · OH-1004

Mitochondrion0.106

Rank 3 · LXL04_026467 · OH-1004

Peroxisome0.095

Rank 4 · LXL04_026467 · OH-1004

Cell membrane0.081

Rank 5 · LXL04_026467 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00106.32adh_short77-245 aa

PF08659.17KR79-166 aa

PF13561.13adh_short_C284-168 aa

PF00106.32adh_short362-504 aa

PF13561.13adh_short_C2362-500 aa

PF13561.13adh_short_C2549-589 aa

PF00106.32adh_short731-895 aa

PF08659.17KR733-818 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026467	`PF00106.32`	adh_short	77	245	3.1e-116	386.4
LXL04_026467	`PF08659.17`	KR	79	166	3.8e-25	89.6
LXL04_026467	`PF13561.13`	adh_short_C2	84	168	2.5e-87	293.1
LXL04_026467	`PF00106.32`	adh_short	362	504	3.1e-116	386.4
LXL04_026467	`PF13561.13`	adh_short_C2	362	500	2.5e-87	293.1
LXL04_026467	`PF13561.13`	adh_short_C2	549	589	2.5e-87	293.1
LXL04_026467	`PF00106.32`	adh_short	731	895	3.1e-116	386.4
LXL04_026467	`PF08659.17`	KR	733	818	3.8e-25	89.6
LXL04_026467	`PF13561.13`	adh_short_C2	738	893	2.5e-87	293.1
LXL04_026467	`PF13561.13`	adh_short_C2	941	984	2.5e-87	293.1
LXL04_026467	`PF28509.1`	DUF8418	1055	1093	4.1e-17	62.4
LXL04_026467	`PF00106.32`	adh_short	1177	1401	3.1e-116	386.4
LXL04_026467	`PF08659.17`	KR	1180	1263	3.8e-25	89.6
LXL04_026467	`PF13561.13`	adh_short_C2	1185	1266	2.5e-87	293.1
LXL04_026467	`PF13561.13`	adh_short_C2	1297	1403	2.5e-87	293.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2E2`	Arabidopsis thaliana	(+)-neomenthol dehydrogenase	50.182%	Swiss-Prot	weak database homology
`Q9ZUH5`	Arabidopsis thaliana	Short-chain dehydrogenase/reductase 2b	48.364%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card