Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1680 bp · TkA06G009020|TK1151|cDNA
TTCTGTGATAACATAGGGACTTTTGTGCTATTTACCCTCTATTAAAAGACTTGTATACGCACACACTGATACCTCCATGTTTACCCGTCGCCAAACTCTTCCATTTCCTATTTCCTTATTTCAAGCCATCACCCTTCCATGTTACTTAACATAGATACGATGGAGGTGCAATGTAGGAATACAGCGAACCAATTTGGGTTTTTTCTTCAGTCTCTTATCTCTGTTTTCCAAGATTGAACATAAAAATTAAAACTTGGATA...
792 bp · TkA06G009020|TK1151|CDS
ATGGACGATATATGTCAAGCTATCAGCTGTTCTTATGGGTTCTCAAGGATTAACCAAAGGCTCTTTGGCTTTCCTCAATTATCCTGCACAACTCATGTTCAAATCCACAAAGGTTCTACCTGTTATGATAATGGGTGCCTTCATTCCTGGTTAAAAAGGAAGTACCCACCACATGAATATCTTTCTGCCGTTCTTTTAGTTGTTGGTTTGATACTCTTCACTTTAGCCGATGCAAATTCTTCTCCTGATTTTAGCTTAAT...
Protein
Download Protein FASTA263 aa · TkA06G009020|TK1151|PROTEIN
MDDICQAISCSYGFSRINQRLFGFPQLSCTTHVQIHKGSTCYDNGCLHSWLKRKYPPHEYLSAVLLVVGLILFTLADANSSPDFSLIGVVMVCGSLIMDSFLGNLQEAIFTINPNTSQMEMLFCSTVVGLPFLVPPMVLTGEVFKAWHSCYEHPYVYGVLVFEAVATFVGQVSVLTLVALFGAATTAMVTTARKAVTLLLSYMIFTKPLTDQHGSGLILIAMGVILKMLPNYKVQRLDTTVKQAKLHRKDHKSVNIEENR...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G009020 |
|---|---|
| TK1151 ID | TkA06G009020 |
| OH-1004 ID | LXL04_026774 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 74.100 |
| Protein coverage (%) | TK1151 80.989 / OH-1004 61.891Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G009020 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:2310434-2313062 (-) | |||||||||
| Description | Similar to UTR2: UDP-galactose/UDP-glucose transporter 2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006478 peptidyl-tyrosine sulfation Biological Process GO:0046963 3'-phosphoadenosine 5'-phosphosulfate transport Biological Process GO:0055085 transmembrane transport Biological Process GO:0072334 UDP-galactose transmembrane transport Biological Process GO:1902558 5'-adenylyl sulfate transmembrane transport Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005802 trans-Golgi network Cellular Component GO:0005886 plasma membrane Cellular Component GO:0005459 UDP-galactose transmembrane transporter activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G12600 ath:AT4G23010 hsa:51000 mmu:108652 pon:100173180 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08449UAA49-229 aaPF00892EamA50-74 aaPF03151TPT51-226 aaPF11239DUF304055-97 aaPF04123DUF37359-201 aaPF20059DUF645861-93 aaPF00892EamA90-226 aaPF11239DUF3040167-185 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G009020 | PF08449 | UAA | 49 | 229 | 3.7e-48 | 165.0 |
| TkA06G009020 | PF00892 | EamA | 50 | 74 | 2.9e-06 | 28.3 |
| TkA06G009020 | PF03151 | TPT | 51 | 226 | 1.9e-07 | 31.5 |
| TkA06G009020 | PF11239 | DUF3040 | 55 | 97 | 1.6 | 9.8 |
| TkA06G009020 | PF04123 | DUF373 | 59 | 201 | 0.17 | 11.9 |
| TkA06G009020 | PF20059 | DUF6458 | 61 | 93 | 8.5 | 7.4 |
| TkA06G009020 | PF00892 | EamA | 90 | 226 | 2.9e-06 | 28.3 |
| TkA06G009020 | PF11239 | DUF3040 | 167 | 185 | 1.6 | 9.8 |
| TkA06G009020 | PF20059 | DUF6458 | 172 | 184 | 8.5 | 7.4 |
| TkA06G009020 | PF04123 | DUF373 | 201 | 232 | 0.17 | 11.9 |
| TkA06G009020 | PF20059 | DUF6458 | 214 | 237 | 8.5 | 7.4 |
| TkA06G009020 | PF11239 | DUF3040 | 216 | 226 | 1.6 | 9.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.