TkA06G008840 | RubberDandelionOmics

Gene overview

TkA06G008840

Reference: TK1151 Chr: Chr06 Coordinates: 2256600-2262889 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3462 bp · TkA06G008840|TK1151|cDNA

ACGGGTATTGCTTTAAAAAAAACTATAAAATTTCCTGGTTCCAGGAATCTGCTTTTGAATATACGAGTCAAACAGAACTGTATTTATGTTAACAACTAAAATGATATAAACAATGTAACGTTGTGAAAGAAGCAACACAAAGTTAAGTGGCGGTCATCGTTTATAACTCAAACACCCTCTTCTTCAGGCAACTTCTCAAACATCAACTTATGAATCAAAACACCATATTTCACATCAAAGCATGACTTCACCTTGTATCA...

CDS

Download CDS FASTA

2838 bp · TkA06G008840|TK1151|CDS

ATGACTTCACCTTGTATCAAAGAAGTCTCTCGAGCCTGTTTCCGACGTTGCTGCCCGACTCCATTACTCCGGCTGCCCGATAAAGAGAGTCCCGAACAAACGATTTCACCTTCCAGGTACGATTTCATAGCTGCAACCGCCTCTTCGCTTCCTCCAAACGCCCAATTCACTAACCATGAGTCGTTGCCGGACCTTGAGCGATCGTTTTCCGCCATGAAAAAAGCTTACCCGTATTACCCGGAAACTGACCGAGCTGACCG...

Protein

Download Protein FASTA

945 aa · TkA06G008840|TK1151|PROTEIN

MTSPCIKEVSRACFRRCCPTPLLRLPDKESPEQTISPSRYDFIAATASSLPPNAQFTNHESLPDLERSFSAMKKAYPYYPETDRADRIRSHEYYHLSNHVCLDYIGNGLFSYSQQLHSNAPFFNIIYKSVNLYTQITHGGQEQDFESLIKERIFRFMNISSDDYALVFTANQSSAFKVLADNYPFHTNRNLLTVYDHENEAVETMIESCKKRSGRVDSALFAWPNMRVHSKRLRKSVVDKNKKKKKRKGLFVFPLQSKVT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G008840`
TK1151 ID	TkA06G008840
OH-1004 ID	LXL04_026493
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.900
Protein coverage (%)	TK1151 65.608 / OH-1004 44.427 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G008840

Location Chr06:2256600-2262889 (-)

Description Similar to HTH: Protein HOTHEAD

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g16540`	Sulfurates the molybdenum cofactor.	The Arabidopsis LOS5/ABA3 locus encodes a molybdenum cofactor sulfurase and modulates cold stress- and osmotic stress-responsive gene expression.2001 · DOI: 10.1105/tpc.010101 ABA3 is a molybdenum cofactor sulfurase required for activation of aldehyde oxidase and xanthine dehydrogenase in Arabidopsis thaliana.2001 · DOI: 10.1074/jbc.c100472200 Tandem orientation of duplicated xanthine dehydrogenase genes from Arabidopsis thaliana: differential gene expression and enzyme activities.2004 · DOI: 10.1074/jbc.m312929200 Characterization of the NifS-like domain of ABA3 from Arabidopsis thaliana provides insight into the mechanism of molybdenum cofactor sulfuration.2005 · DOI: 10.1074/jbc.m411195200 Binding of sulfurated molybdenum cofactor to the C-terminal domain of ABA3 from Arabidopsis thaliana provides insight into the mechanism of molybdenum cofactor sulfuration.2008 · DOI: 10.1074/jbc.m708549200

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0670000`	Sulfurates the molybdenum cofactor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026493 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007267 cell-cell signaling Biological Process

GO:0009553 embryo sac development Biological Process

GO:0010430 fatty acid omega-oxidation Biological Process

GO:0046202 cyanide biosynthetic process Biological Process

GO:0050898 nitrile metabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0033095 aleurone grain Cellular Component

GO:0016614 oxidoreductase activity, acting on CH-OH group of donors Molecular Function

GO:0046593 mandelonitrile lyase activity Molecular Function

GO:0050660 flavin adenine dinucleotide binding Molecular Function

KEGG gene cross-reference

ath:AT1G72970

ath:AT1G73050

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.635

Rank 1 · TkA06G008840 · TK1151

Cytoplasm0.247

Rank 2 · TkA06G008840 · TK1151

Cell membrane0.068

Rank 3 · TkA06G008840 · TK1151

Endoplasmic reticulum0.054

Rank 4 · TkA06G008840 · TK1151

Mitochondrion0.046

Rank 5 · TkA06G008840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04367DUF502104-148 aa

PF03486HI0933_like346-447 aa

PF27346PcoE369-439 aa

PF08731AFT387-408 aa

PF01134GIDA519-560 aa

PF07992Pyr_redox_2765-804 aa

PF01266DAO766-796 aa

PF05834Lycopene_cycl766-795 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G008840	`PF04367`	DUF502	104	148	0.25	12.0
TkA06G008840	`PF03486`	HI0933_like	346	447	0.23	11.6
TkA06G008840	`PF27346`	PcoE	369	439	0.066	14.0
TkA06G008840	`PF08731`	AFT	387	408	0.13	13.3
TkA06G008840	`PF01134`	GIDA	519	560	0.27	11.0
TkA06G008840	`PF07992`	Pyr_redox_2	765	804	0.052	13.7
TkA06G008840	`PF01266`	DAO	766	796	0.02	15.2
TkA06G008840	`PF05834`	Lycopene_cycl	766	795	0.08	12.7
TkA06G008840	`PF03486`	HI0933_like	766	801	0.23	11.6
TkA06G008840	`PF01134`	GIDA	766	801	0.27	11.0
TkA06G008840	`PF13450`	NAD_binding_8	769	797	0.0018	19.3
TkA06G008840	`PF08731`	AFT	799	860	0.13	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C5X8`	Arabidopsis thaliana	sp\|Q9C5X8\|MOCOS_ARATH Molybdenum cofactor sulfurase	25.100%	Swiss-Prot	Low
`Q655R6`	Oryza sativa subsp. japonica	sp\|Q655R6\|MOCOS_ORYSJ Molybdenum cofactor sulfurase	25.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card