TkA06G004920 | RubberDandelionOmics

Gene overview

TkA06G004920

Reference: TK1151 Chr: Chr06 Coordinates: 1251312-1261562 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1643 bp · TkA06G004920|TK1151|cDNA

TTAATTTCCTCTTTTCTCAAATGATGTCTTGGTCTTTCGTTTCTAATCTCAGCCTATTGCTACTAATTCTAGCAACACAATCCTTGGAAGCTCGTTGGTTGCCGTGTCAGCTAAATGGATCATGTTCACTTATAGAAACAATAAGAGAACAAGATGATGGCACAATATGGGCGGTTCTTGTTGCTGGATCAAATGGATACTATAATTATAGACATCAGGCTGACGTTTGCCATGCATATCAAATACTAAAAGGAAGAGGA...

CDS

Download CDS FASTA

1527 bp · TkA06G004920|TK1151|CDS

ACTATTCTTATTTGGAACCAACCTCATGGCCATTTTCAAGGCCACCTTCTTTTGTTGCCATGCACCACAATTTCTTTAGTAGAATGGGAAAACGAAATCAGGAAATCTAAGAGCCTATTGCTACTAATTCTAGCAACACAATCCTTGGAAGCTCGTTGGTTGCCGTGTCAGCTAAATGGATCATGTTCACTTATAGAAACAATAAGAGAACAAGATGATGGCACAATATGGGCGGTTCTTGTTGCTGGATCAAATGGATA...

Protein

Download Protein FASTA

508 aa · TkA06G004920|TK1151|PROTEIN

TILIWNQPHGHFQGHLLLLPCTTISLVEWENEIRKSKSLLLLILATQSLEARWLPCQLNGSCSLIETIREQDDGTIWAVLVAGSNGYYNYRHQADVCHAYQILKGRGLMDENIIVFMYDDIAHHESNPKPGVIINNPKGDDVYAGVPKDYTGDSLTAANLYAVILGDKKSVTGGSGKVLDSKSNDRVFIYYTDHGGPGTLGMPDSPNVYAKDFIDVLEKKHASRTYKEMVIYVESCESGSIFEGLLSENLNIYVTTASKA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G004920`
TK1151 ID	TkA06G004920
OH-1004 ID	LXL04_026556
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 99.804 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G004920

Location Chr06:1251312-1261562 (-)

Description Similar to Vacuolar-processing enzyme

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g62710`	Asparagine-specific endopeptidase involved in the processing of vacuolar seed protein precursors into the mature forms (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0644000`	Asparaginyl endopeptidase that may act as an activator of REP1.	No verified direct reference in this release
`UniProt: B8ASK4`	Asparagine-specific endopeptidase that may be involved in processing of proteins targeted to vacuoles (By similarity).	No verified direct reference in this release
`Os04g0537900`	Asparagine-specific endopeptidase that may be involved in processing of proteins targeted to vacuoles.	The vacuolar processing enzyme OsVPE1 is required for efficient glutelin processing in rice.2009 · DOI: 10.1111/j.1365-313x.2009.03801.x Vacuolar processing enzyme plays an essential role in the crystalline structure of glutelin in rice seed.2010 · DOI: 10.1093/pcp/pcp165

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026556 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006624 vacuolar protein processing Biological Process

GO:0051603 proteolysis involved in protein catabolic process Biological Process

GO:0000326 protein storage vacuole Cellular Component

GO:0005773 vacuole Cellular Component

GO:0004175 endopeptidase activity Molecular Function

GO:0004197 cysteine-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G62710

dosa:Os02g0644000

gmx:547964

osa:4330133

rcu:8272115

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.593

Rank 1 · TkA06G004920 · TK1151

Extracellular0.204

Rank 2 · TkA06G004920 · TK1151

Cytoplasm0.166

Rank 3 · TkA06G004920 · TK1151

Endoplasmic reticulum0.140

Rank 4 · TkA06G004920 · TK1151

Golgi apparatus0.092

Rank 5 · TkA06G004920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01650Peptidase_C1377-346 aa

PF20985Legum_prodom395-491 aa

PF01650Peptidase_C13467-489 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G004920	`PF01650`	Peptidase_C13	77	346	2.8e-113	378.4
TkA06G004920	`PF20985`	Legum_prodom	395	491	2e-38	131.3
TkA06G004920	`PF01650`	Peptidase_C13	467	489	2.8e-113	378.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39044`	Arabidopsis thaliana	sp\|Q39044\|VPEB_ARATH Vacuolar-processing enzyme beta-isozyme	60.400%	Swiss-Prot	High
`Q8GS39`	Oryza sativa subsp. japonica	sp\|Q8GS39\|REP2_ORYSJ Asparaginyl endopeptidase Rep2	61.000%	Swiss-Prot	High
`B8ASK4`	Oryza sativa subsp. indica	sp\|B8ASK4\|VPE1_ORYSI Vacuolar-processing enzyme beta-isozyme 1	58.400%	Swiss-Prot	High
`Q84LM2`	Oryza sativa subsp. japonica	sp\|Q84LM2\|VPE1_ORYSJ Vacuolar-processing enzyme beta-isozyme 1	58.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card