TkA06G004480 | RubberDandelionOmics

Gene overview

TkA06G004480

Reference: TK1151 Chr: Chr06 Coordinates: 1082296-1082700 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

363 bp · TkA06G004480|TK1151|cDNA

ATGAAGATACCTTGTTGCACGGTCTGTCACACAAGGTACAACGAAGAAGATAGGTGTCCGTTGTTACTCGAGTGCGGCCATGGATTCTGTAAAGAGTGTCTCTCTCGTATGTTTTCATCAGCGTCATCAGACACTACTCTTTCTTGTCCACGAAGTCGCCAAGTCTGCGTTGTCGGGCTAATCTCTTCTGCTTCCAATAGCGATTTTACCGACGAAGACGAAGACGATGAGGACGATGGGTTGGTGGTGGTGGTGGATAG...

CDS

Download CDS FASTA

363 bp · TkA06G004480|TK1151|CDS

ATGAAGATACCTTGTTGCACGGTCTGTCACACAAGGTACAACGAAGAAGATAGGTGTCCGTTGTTACTCGAGTGCGGCCATGGATTCTGTAAAGAGTGTCTCTCTCGTATGTTTTCATCAGCGTCATCAGACACTACTCTTTCTTGTCCACGAAGTCGCCAAGTCTGCGTTGTCGGGCTAATCTCTTCTGCTTCCAATAGCGATTTTACCGACGAAGACGAAGACGATGAGGACGATGGGTTGGTGGTGGTGGTGGATAG...

Protein

Download Protein FASTA

120 aa · TkA06G004480|TK1151|PROTEIN

MKIPCCTVCHTRYNEEDRCPLLLECGHGFCKECLSRMFSSASSDTTLSCPRSRQVCVVGLISSASNSDFTDEDEDDEDDGLVVVVDRDRRSCGSNASSSNGLIELGSHQDLRMVRRSCNG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G004480`
TK1151 ID	TkA06G004480
OH-1004 ID	LXL04_026568
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	88.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G004480

Location Chr06:1082296-1082700 (+)

Description Similar to KEG: E3 ubiquitin-protein ligase KEG

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13530`	Mediates E2-dependent protein ubiquitination.	Powdery mildew resistance conferred by loss of the ENHANCED DISEASE RESISTANCE1 protein kinase is suppressed by a missense mutation in KEEP ON GOING, a regulator of abscisic acid signaling.2008 · DOI: 10.1104/pp.108.127605

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026568 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000209 protein polyubiquitination Biological Process

GO:0002224 toll-like receptor signaling pathway Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0006952 defense response Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010508 positive regulation of autophagy Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0016197 endosomal transport Biological Process

GO:0016567 protein ubiquitination Biological Process

KEGG gene cross-reference

ath:AT5G13530

hsa:373

mmu:55992

mmu:81003

rno:81002

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.568

Rank 1 · TkA06G004480 · TK1151

Cytoplasm0.439

Rank 2 · TkA06G004480 · TK1151

Cell membrane0.088

Rank 3 · TkA06G004480 · TK1151

Lysosome / Vacuole0.050

Rank 4 · TkA06G004480 · TK1151

Endoplasmic reticulum0.041

Rank 5 · TkA06G004480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21363TRAF3_RING4-9 aa

PF13639zf-RING_25-50 aa

PF15227zf-C3HC4_45-14 aa

PF13920zf-C3HC4_35-50 aa

PF25454zf-C3HC4_IRF-2BP1_25-58 aa

PF12678zf-rbx15-50 aa

PF17121zf-C3HC4_55-42 aa

PF13445zf-RING_UBOX6-50 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G004480	`PF21363`	TRAF3_RING	4	9	0.0046	17.4
TkA06G004480	`PF13639`	zf-RING_2	5	50	1.1e-06	29.5
TkA06G004480	`PF15227`	zf-C3HC4_4	5	14	0.0003	21.6
TkA06G004480	`PF13920`	zf-C3HC4_3	5	50	0.0062	17.0
TkA06G004480	`PF25454`	zf-C3HC4_IRF-2BP1_2	5	58	0.022	15.7
TkA06G004480	`PF12678`	zf-rbx1	5	50	0.025	15.5
TkA06G004480	`PF17121`	zf-C3HC4_5	5	42	0.065	13.8
TkA06G004480	`PF13445`	zf-RING_UBOX	6	50	9.3e-08	32.7
TkA06G004480	`PF14634`	zf-RING_5	6	50	2.5e-06	28.1
TkA06G004480	`PF00097`	zf-C3HC4	6	50	2.9e-06	27.7
TkA06G004480	`PF13923`	zf-C3HC4_2	6	40	0.0031	18.0
TkA06G004480	`PF23412`	zf_RING_Vps8	6	43	0.066	13.8
TkA06G004480	`PF24921`	RING_XB3-XBAT31	6	56	0.079	13.7
TkA06G004480	`PF14570`	zf-RING_4	6	54	0.09	13.3
TkA06G004480	`PF15227`	zf-C3HC4_4	20	50	0.0003	21.6
TkA06G004480	`PF21363`	TRAF3_RING	23	46	0.0046	17.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FY48`	Arabidopsis thaliana	sp\|Q9FY48\|KEG_ARATH E3 ubiquitin-protein ligase KEG	50.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card