TkA05G472780 | RubberDandelionOmics

Gene overview

TkA05G472780

Reference: TK1151 Chr: Chr05 Coordinates: 118637437-118639655 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1623 bp · TkA05G472780|TK1151|cDNA

ATTTGAGGCTCGAAGTGTGATTTCCTCTACGTTCAGTACTCATAACCCTATCGGCTTTTAGCCGCCTCTTTTCTCGCATTCGGTTGGAAATTCTTCCCTCATTTCTCCGGTCATTCTTTTGGAAAACATGCAGTCTGCAGCCGTCGCTCACCGCCACTTCCTCGATGGCGGCGCCACCGCCGCCTTCCCCTTTTCCCATCTCAAATCCACTCCTACCGCCAGCCCATTCTCAGTTCGTATGTCACTACGTGAGGACGCCC...

CDS

Download CDS FASTA

1146 bp · TkA05G472780|TK1151|CDS

ATGCAGTCTGCAGCCGTCGCTCACCGCCACTTCCTCGATGGCGGCGCCACCGCCGCCTTCCCCTTTTCCCATCTCAAATCCACTCCTACCGCCAGCCCATTCTCAGTTCGTATGTCACTACGTGAGGACGCCCCATCTCTCGCTGTTGTCGGCGTCACTGGTGCCGTCGGTCAGGAGTTTCTATCCGTCCTCTCCGACCGATCCTTCCCCTACCGATCTATAAAAATGCTTGCTAGCAAACGCTCCGCCGGAAAGAAATA...

Protein

Download Protein FASTA

381 aa · TkA05G472780|TK1151|PROTEIN

MQSAAVAHRHFLDGGATAAFPFSHLKSTPTASPFSVRMSLREDAPSLAVVGVTGAVGQEFLSVLSDRSFPYRSIKMLASKRSAGKKYTFEDNEYVVEELTADSFKDVDIALFSAGGSISKEFGPIAAKCGSVVVDNSSAFRMDDGVPLVIPEVNPDAMSHIKLGSGKGAIIANPNCSTIICLMAATPLHRRAKVLRMVVSTYQAASGAGAAAMEELELQTREVLEGKRPTCKIFKQQYAFNLFSHNAPVLPNGYNEEEMK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G472780`
TK1151 ID	TkA05G472780
OH-1004 ID	LXL04_022506
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G472780`
Location	Chr05:118637437-118639655 (+)
Description	Similar to asd: Aspartate-semialdehyde dehydrogenase (Synechocystis sp. (strain PCC 6803 / Kazusa)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_022506` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006526 L-arginine biosynthetic process Biological Process GO:0009088 L-threonine biosynthetic process Biological Process GO:0009089 L-lysine biosynthetic process via diaminopimelate Biological Process GO:0009097 isoleucine biosynthetic process Biological Process GO:0019877 diaminopimelate biosynthetic process Biological Process GO:0071266 'de novo' L-methionine biosynthetic process Biological Process GO:0003942 N-acetyl-gamma-glutamyl-phosphate reductase activity Molecular Function GO:0004073 aspartate-semialdehyde dehydrogenase activity Molecular Function GO:0046983 protein dimerization activity Molecular Function GO:0050661 NADP binding Molecular Function GO:0051287 NAD binding Molecular Function
KEGG gene cross-reference	aae:aq_1866 pma:Pro_1814 syn:slr0549 vch:VC_2107 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.970

Rank 1 · TkA05G472780 · TK1151

Cytoplasm0.058

Rank 2 · TkA05G472780 · TK1151

Mitochondrion0.050

Rank 3 · TkA05G472780 · TK1151

Peroxisome0.037

Rank 4 · TkA05G472780 · TK1151

Nucleus0.026

Rank 5 · TkA05G472780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01118Semialdhyde_dh47-159 aa

PF22698Semialdhyde_dhC_1181-220 aa

PF02774Semialdhyde_dhC187-367 aa

PF02780Transketolase_C190-218 aa

PF01118Semialdhyde_dh254-279 aa

PF22698Semialdhyde_dhC_1267-342 aa

PF02780Transketolase_C290-323 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G472780	`PF01118`	Semialdhyde_dh	47	159	2.5e-34	119.0
TkA05G472780	`PF22698`	Semialdhyde_dhC_1	181	220	0.16	12.5
TkA05G472780	`PF02774`	Semialdhyde_dhC	187	367	1.1e-44	153.5
TkA05G472780	`PF02780`	Transketolase_C	190	218	0.21	12.2
TkA05G472780	`PF01118`	Semialdhyde_dh	254	279	2.5e-34	119.0
TkA05G472780	`PF22698`	Semialdhyde_dhC_1	267	342	0.16	12.5
TkA05G472780	`PF02780`	Transketolase_C	290	323	0.21	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card