TkA05G465990 | RubberDandelionOmics

Gene overview

TkA05G465990

Reference: TK1151 Chr: Chr05 Coordinates: 116835682-116841091 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2614 bp · TkA05G465990|TK1151|cDNA

AACAAGGCTATGACGCTATGGGGCGGAAGAATAACCATGGAATCGGGTCAAACTTCGGGTATAAAATGTAGACGCGTCGGTGCGCACCACGTGTATGTTGTGTACCCTGCTTCCCACTTTCCTCCATCTCCCTATTTTGCCACGATTTTCTTGAGATTTTCTTATTTTTCGGTGGTTCATGATTTGTGGAAGTAAATCACACGATTTGTCAACATCTTCAATACCTGTAGACCGACCTCGCACTTTCTCTTTCTGAAAAC...

CDS

Download CDS FASTA

1959 bp · TkA05G465990|TK1151|CDS

ATGATTTGTCAATCGCCATCTGCAAGCTTTGATTCATCCAAGATTTTATGGATGTCATCACCGCCCATTTGCCCATGTCAGACATCAATCCAATTGAGTTCCAGTACAAGAACGGGAATCCATACCTCCATTAGTCGAAAAAAAGTCTCAAGGAGAAGAAGAAAGGGGTTGATTTGGGCTTGTATGGTTCCCATCGATGGAAAAAACCAAAATTTGAGAGTCGGCTTTGCGAATTCGATTACAAGCGGGTTGAAAAACTT...

Protein

Download Protein FASTA

652 aa · TkA05G465990|TK1151|PROTEIN

MICQSPSASFDSSKILWMSSPPICPCQTSIQLSSSTRTGIHTSISRKKVSRRRRKGLIWACMVPIDGKNQNLRVGFANSITSGLKNFAESQNSNELDEPGESSSHDSTQSGYTNDFTGFADDPIVGKLRTQLGLIHPIPFPPLNRNIGGLFLFFFVFGVVFDKLWTSRKRKSDDDVDNPATWPQVPTSFSLFLEKDLQRKESVEWVNMVLSKLWKVYRGGLENWVIGLLQPVIDDLKKPDYVKRVEIKQFSLGDEPFVVR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G465990`
TK1151 ID	TkA05G465990
OH-1004 ID	LXL04_022415
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G465990`
Location	Chr05:116835682-116841091 (+)
Description	Similar to SYT3: Synaptotagmin-3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_022415` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0006869 lipid transport Biological Process GO:0009306 protein secretion Biological Process GO:0009414 response to water deprivation Biological Process GO:0009651 response to salt stress Biological Process GO:0009958 positive gravitropism Biological Process GO:0035621 ER to Golgi ceramide transport Biological Process GO:0045892 negative regulation of DNA-templated transcription Biological Process GO:0061817 endoplasmic reticulum-plasma membrane tethering Biological Process GO:0071476 cellular hypotonic response Biological Process GO:0090158 endoplasmic reticulum membrane organization Biological Process GO:0120009 intermembrane lipid transfer Biological Process
KEGG gene cross-reference	ath:AT1G20080 ath:AT3G61050 ath:AT5G04220 hsa:23344 spo:2542267 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.971

Rank 1 · TkA05G465990 · TK1151

Nucleus0.027

Rank 2 · TkA05G465990 · TK1151

Cytoplasm0.026

Rank 3 · TkA05G465990 · TK1151

Cell membrane0.026

Rank 4 · TkA05G465990 · TK1151

Peroxisome0.024

Rank 5 · TkA05G465990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25283DUF7873156-199 aa

PF10296MMM1196-276 aa

PF25669SMP_MUG190-like201-263 aa

PF26547PDZD8_N201-378 aa

PF25669SMP_MUG190-like286-387 aa

PF00168C2409-501 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G465990	`PF25283`	DUF7873	156	199	0.43	11.0
TkA05G465990	`PF10296`	MMM1	196	276	0.0012	19.0
TkA05G465990	`PF25669`	SMP_MUG190-like	201	263	2.5e-17	63.9
TkA05G465990	`PF26547`	PDZD8_N	201	378	9.9e-06	26.1
TkA05G465990	`PF25669`	SMP_MUG190-like	286	387	2.5e-17	63.9
TkA05G465990	`PF00168`	C2	409	501	9.7e-11	42.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card