LXL04_022415 | RubberDandelionOmics

Gene overview

LXL04_022415

Reference: OH-1004 Chr: Chr04 Coordinates: 149737939-149740333 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1959 bp · LXL04_022415|LXL04_022415|OH1004|cDNA

ATGATTTGTCAATCGCCATCTGCAAGCTTTGATTCATCCAAGATTTTATGGATGTCATCACCGCCCATTTGCCCATGTCAGACATCAATCCAATTGAGTTCCAGTACAAGAACGGGAATCCATACCTCCATTAGTCGAAAAAAAGTCtcaaggagaagaagaaaggggTTGATTTGGGCTTGTATGGTTCCCATCGATGGAAAAAACCAAAATTTGAGAGTCGGCTTTGCGAATTCGATTACAAGCGGGTTGAAAAACTT...

CDS

Download CDS FASTA

1959 bp · LXL04_022415|LXL04_022415|OH1004|CDS

ATGATTTGTCAATCGCCATCTGCAAGCTTTGATTCATCCAAGATTTTATGGATGTCATCACCGCCCATTTGCCCATGTCAGACATCAATCCAATTGAGTTCCAGTACAAGAACGGGAATCCATACCTCCATTAGTCGAAAAAAAGTCTCAAGGAGAAGAAGAAAGGGGTTGATTTGGGCTTGTATGGTTCCCATCGATGGAAAAAACCAAAATTTGAGAGTCGGCTTTGCGAATTCGATTACAAGCGGGTTGAAAAACTT...

Protein

Download Protein FASTA

652 aa · LXL04_022415|LXL04_022415|OH1004|PROTEIN

MICQSPSASFDSSKILWMSSPPICPCQTSIQLSSSTRTGIHTSISRKKVSRRRRKGLIWACMVPIDGKNQNLRVGFANSITSGLKNFAESQNSNELDEPGESSSHDSTQSGYSNDFTGFADDPIVGKLRTQLGLIHPIPFPPLNRNIGGLFLFFFVFGVVFDKLWTSRKRKSDDDVDNPATWPQVPTSFSLFLEKDLQRKESVEWVNMVLSKLWKVYRGGLENWVIGLLQPVIDDLKKPDYVKRVEIKQFSLGDEPFVVR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022415`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022415

Location Chr04:149737939-149740333 (+)

Description Similar to SYT3: Synaptotagmin-3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g04220`	May be involved in membrane trafficking.	No verified direct reference in this release
`At1g20080`	May play an important role in regulating an unconventional protein trafficking from the cytosol to the extracellular matrix.	Golgi apparatus-localized synaptotagmin 2 is required for unconventional secretion in Arabidopsis.2011 · DOI: 10.1371/journal.pone.0026477
`At3g61050`	May be involved in membrane trafficking (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022415 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006869 lipid transport Biological Process

GO:0009306 protein secretion Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009958 positive gravitropism Biological Process

GO:0035621 ER to Golgi ceramide transport Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0061817 endoplasmic reticulum-plasma membrane tethering Biological Process

GO:0071476 cellular hypotonic response Biological Process

GO:0090158 endoplasmic reticulum membrane organization Biological Process

GO:0120009 intermembrane lipid transfer Biological Process

KEGG gene cross-reference

ath:AT1G20080

ath:AT3G61050

ath:AT5G04220

hsa:23344

spo:2542267

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.970

Rank 1 · LXL04_022415 · OH-1004

Nucleus0.027

Rank 2 · LXL04_022415 · OH-1004

Cytoplasm0.027

Rank 3 · LXL04_022415 · OH-1004

Cell membrane0.026

Rank 4 · LXL04_022415 · OH-1004

Peroxisome0.024

Rank 5 · LXL04_022415 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25669.2SMP_MUG190-like201-263 aa

PF26547.1PDZD8_N201-378 aa

PF25669.2SMP_MUG190-like286-387 aa

PF00168.37C2409-501 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022415	`PF25669.2`	SMP_MUG190-like	201	263	2.5e-17	63.9
LXL04_022415	`PF26547.1`	PDZD8_N	201	378	9.9e-06	26.1
LXL04_022415	`PF25669.2`	SMP_MUG190-like	286	387	2.5e-17	63.9
LXL04_022415	`PF00168.37`	C2	409	501	9.7e-11	42.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7XA06`	Arabidopsis thaliana	Synaptotagmin-3	23.958%	Swiss-Prot	weak database homology
`B6ETT4`	Arabidopsis thaliana	Synaptotagmin-2	22.549%	Swiss-Prot	weak database homology
`Q9LEX1`	Arabidopsis thaliana	Calcium-dependent lipid-binding protein	22.449%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card