TkA05G465140 | RubberDandelionOmics

Gene overview

TkA05G465140

Reference: TK1151 Chr: Chr05 Coordinates: 116575864-116576202 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

339 bp · TkA05G465140|TK1151|cDNA

ATGGAGAAACCTGTTGCAGAAAAAAAATACCGGCCGCAACTAACAATGGCGATCTTGATTCCAGCTTTCCAACAATTAACAGGGATTAACGTGATTATGTTTTATGCCCCTGTTTTATTTAAAACACTCGGATTTGGCGGCAAGGCTTCTCTTATGACTGCTGTGATTATTGGTTCGGTGAATGTTGTTGCAACCTGTGTTTCAATCCACGGTGTTGACAATTGGGGAAGAAGGTTTCTTTTTCTTGAAGGCGGATCGAT...

CDS

Download CDS FASTA

339 bp · TkA05G465140|TK1151|CDS

ATGGAGAAACCTGTTGCAGAAAAAAAATACCGGCCGCAACTAACAATGGCGATCTTGATTCCAGCTTTCCAACAATTAACAGGGATTAACGTGATTATGTTTTATGCCCCTGTTTTATTTAAAACACTCGGATTTGGCGGCAAGGCTTCTCTTATGACTGCTGTGATTATTGGTTCGGTGAATGTTGTTGCAACCTGTGTTTCAATCCACGGTGTTGACAATTGGGGAAGAAGGTTTCTTTTTCTTGAAGGCGGATCGAT...

Protein

Download Protein FASTA

112 aa · TkA05G465140|TK1151|PROTEIN

MEKPVAEKKYRPQLTMAILIPAFQQLTGINVIMFYAPVLFKTLGFGGKASLMTAVIIGSVNVVATCVSIHGVDNWGRRFLFLEGGSICDVQFDINPNPIFSPSVIRIILIVL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G465140`
TK1151 ID	TkA05G465140
OH-1004 ID	LXL04_027185
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	73.800
Protein coverage (%)	TK1151 82.143 / OH-1004 19.770 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G465140

Location Chr05:116575864-116576202 (+)

Description Similar to STC: Sugar carrier protein C

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g21480`	Mediates an active uptake of hexoses, probably by sugar/hydrogen symport.	No verified direct reference in this release
`At1g11260`	Major hexose transporter.	Monosaccharide/proton symporter AtSTP1 plays a major role in uptake and response of Arabidopsis seeds and seedlings to sugars.2000 · DOI: 10.1046/j.1365-313x.2000.00935.x Functional expression of a plant plasma membrane transporter in Xenopus oocytes.1992 · DOI: 10.1016/0014-5793(92)80431-f Primary structure, genomic organization and heterologous expression of a glucose transporter from Arabidopsis thaliana.1990 · DOI: 10.1002/j.1460-2075.1990.tb07500.x Functional reconstitution of the solubilized Arabidopsis thaliana STP1 monosaccharide-H+ symporter in lipid vesicles and purification of the histidine tagged protein from transgenic Saccharomyces cerevisiae.1994 · DOI: 10.1046/j.1365-313x.1994.6020225.x Steady-state and presteady-state kinetics of the H+/hexose cotransporter (STP1) from Arabidopsis thaliana expressed in Xenopus oocytes.1994 · DOI: 10.1016/s0021-9258(17)32008-2

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0178200`	Mediates active uptake of hexoses by sugar:proton symport.	Characterization of rice functional monosaccharide transporter, OsMST5.2003 · DOI: 10.1271/bbb.67.556
`Os01g0567600`	Mediates active uptake of hexoses by sugar:proton symport.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027185 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009624 response to nematode Biological Process

GO:0015749 monosaccharide transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0015145 monosaccharide transmembrane transporter activity Molecular Function

GO:0015293 symporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G11260

ath:AT4G21480

dosa:Os07g0106200

dosa:Os07g0559700

osa:4343590

rcu:8275367

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.390

Rank 1 · TkA05G465140 · TK1151

Endoplasmic reticulum0.207

Rank 2 · TkA05G465140 · TK1151

Lysosome / Vacuole0.167

Rank 3 · TkA05G465140 · TK1151

Cytoplasm0.121

Rank 4 · TkA05G465140 · TK1151

Golgi apparatus0.089

Rank 5 · TkA05G465140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00083Sugar_tr7-88 aa

PF07690MFS_112-82 aa

PF15038Jiraiya28-77 aa

PF19333FAXC_N46-87 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G465140	`PF00083`	Sugar_tr	7	88	2.3e-24	86.8
TkA05G465140	`PF07690`	MFS_1	12	82	0.0047	16.6
TkA05G465140	`PF15038`	Jiraiya	28	77	0.19	12.0
TkA05G465140	`PF19333`	FAXC_N	46	87	0.059	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65413`	Arabidopsis thaliana	sp\|O65413\|STP12_ARATH Sugar transport protein 12	78.500%	Swiss-Prot	High
`P23586`	Arabidopsis thaliana	sp\|P23586\|STP1_ARATH Sugar transport protein 1	77.200%	Swiss-Prot	High
`Q6ZKF0`	Oryza sativa subsp. japonica	sp\|Q6ZKF0\|MST5_ORYSJ Sugar transport protein MST5	72.000%	Swiss-Prot	High
`Q94EC3`	Oryza sativa subsp. japonica	sp\|Q94EC3\|MST7_ORYSJ Sugar transport protein MST7	70.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card