TkA05G458560 | RubberDandelionOmics

Gene overview

TkA05G458560

Reference: TK1151 Chr: Chr05 Coordinates: 114897746-114903161 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3289 bp · TkA05G458560|TK1151|cDNA

GTTCTTTAGATTTGAAATTGATGTTTTTTCTGATGATAGAGGTGGTGGTAATATTTTATTCCTGGTGGCAGACGTGGTAGTCTGGCGGCACAAGATATACTTAAAAAAATTATTGATAGAGTAGACCCTCACTCACGCCCACTACCCACTCACAAGTCGTTCAAGTCTTCCATCCACAGAGACTTCTAGAGAGAGAGAGAGAGAGAGAGTCCTTTCTCTCCACGTCGTATGAGGCAATTCCAACCAATGGAACACTGCCA...

CDS

Download CDS FASTA

2454 bp · TkA05G458560|TK1151|CDS

ATGAGGAAGTGGACTCTTCCGTCCGTATTGTTTCTGCTATGTCTCCTCTGTCTTCTTCCAGATCAAGGTCGCAAATTACATGCGAACGCAGAGGCTGATTCAGATGATTTAGTGAATCCACCCAAGATTGAAGACAAGCTTGGTGCCGTTCCACATGGTTTGTCTACGGATTCAGACGTTGCCAAGAGGGAAGCGGAGTCAATGTCCAGGAAAAACCTCCGCAGCAATGCTGAGAAGTTTGAGTTCCAAGCTGAAGTATC...

Protein

Download Protein FASTA

817 aa · TkA05G458560|TK1151|PROTEIN

MRKWTLPSVLFLLCLLCLLPDQGRKLHANAEADSDDLVNPPKIEDKLGAVPHGLSTDSDVAKREAESMSRKNLRSNAEKFEFQAEVSRLMDIIINSLYSNKDIFLRELISNASDALDKIRFLSLTDKEVLGEGDDTKLEIQIKLDKENKILSIRDRGVGMTKDDLIKNLGTIAKSGTSAFVEKMQTSGDLNLIGQFGVGFYSVYLVADYVEVISKHNDDKQYVWESKADGAFAISEDTYNEPLGRGTEIRIHLKDEAGEY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G458560`
TK1151 ID	TkA05G458560
OH-1004 ID	LXL04_022327
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.000
Protein coverage (%)	TK1151 99.388 / OH-1004 47.717 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G458560

Location Chr05:114897746-114903161 (+)

Description Similar to HSP90-7: Endoplasmin homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24190`	May have a molecular chaperone role in the processing of secreted materials.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022327 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0006457 protein folding Biological Process

GO:0009306 protein secretion Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009934 regulation of meristem structural organization Biological Process

GO:0010075 regulation of meristem growth Biological Process

GO:0030070 insulin processing Biological Process

GO:0030177 positive regulation of Wnt signaling pathway Biological Process

GO:0030970 retrograde protein transport, ER to cytosol Biological Process

GO:0031247 actin rod assembly Biological Process

GO:0034123 positive regulation of toll-like receptor signaling pathway Biological Process

KEGG gene cross-reference

ath:AT4G24190

mmu:22027

rno:362862

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.832

Rank 1 · TkA05G458560 · TK1151

Cytoplasm0.117

Rank 2 · TkA05G458560 · TK1151

Golgi apparatus0.113

Rank 3 · TkA05G458560 · TK1151

Nucleus0.080

Rank 4 · TkA05G458560 · TK1151

Extracellular0.052

Rank 5 · TkA05G458560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25794SACS87-216 aa

PF22016DUF6933101-145 aa

PF02518HATPase_c104-255 aa

PF13589HATPase_c_3105-220 aa

PF00183HSP90259-798 aa

PF07985SRR1393-472 aa

PF19995iSTAND483-540 aa

PF01751Toprim526-603 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G458560	`PF25794`	SACS	87	216	5.3e-05	23.8
TkA05G458560	`PF22016`	DUF6933	101	145	0.045	14.3
TkA05G458560	`PF02518`	HATPase_c	104	255	1.9e-07	32.2
TkA05G458560	`PF13589`	HATPase_c_3	105	220	5.4e-08	33.7
TkA05G458560	`PF00183`	HSP90	259	798	2.7e-215	716.9
TkA05G458560	`PF07985`	SRR1	393	472	0.12	13.0
TkA05G458560	`PF19995`	iSTAND	483	540	0.11	13.7
TkA05G458560	`PF01751`	Toprim	526	603	0.044	14.7
TkA05G458560	`PF19995`	iSTAND	566	670	0.11	13.7
TkA05G458560	`PF25794`	SACS	586	614	5.3e-05	23.8
TkA05G458560	`PF07985`	SRR1	588	647	0.12	13.0
TkA05G458560	`PF22016`	DUF6933	644	683	0.045	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STX5`	Arabidopsis thaliana	sp\|Q9STX5\|ENPL_ARATH Endoplasmin homolog	85.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card