TkA05G450450 | RubberDandelionOmics

Gene overview

TkA05G450450

Reference: TK1151 Chr: Chr05 Coordinates: 112639680-112640699 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

899 bp · TkA05G450450|TK1151|cDNA

GTATAAGTAACCTTCCGATTCTAATCCCCACTATATTGGACACACTCAAACCCACACAAACATTTCTTCAAACACCTTGTAAACACTTTGCGACTTTAGAGTTTAGATATGAATTCAGGTGACGATGCTTCAGTTACAAGTTCTTCGGTTTCTTCCTTCGGTAAATTCTTCAAGCAATTAGCATCCCCCACTAGGAAACCCCCGATTCCTGGCGGTTCCGATGACATCCATCAGGTGTTTAATTACTTTGACGAGAACGG...

CDS

Download CDS FASTA

528 bp · TkA05G450450|TK1151|CDS

ATGAATTCAGGTGACGATGCTTCAGTTACAAGTTCTTCGGTTTCTTCCTTCGGTAAATTCTTCAAGCAATTAGCATCCCCCACTAGGAAACCCCCGATTCCTGGCGGTTCCGATGACATCCATCAGGTGTTTAATTACTTTGACGAGAACGGAGACGGGAAGATATCTCCCGAGGAGCTGAAGAACAGGTTTAGGAAGGTAGGCGGGGAGGAGAGTCAGTTATCGGACGAGGAGGCGGAGATGGTAGTGCGGTTGTCGGA...

Protein

Download Protein FASTA

175 aa · TkA05G450450|TK1151|PROTEIN

MNSGDDASVTSSSVSSFGKFFKQLASPTRKPPIPGGSDDIHQVFNYFDENGDGKISPEELKNRFRKVGGEESQLSDEEAEMVVRLSDADGDGVLGLDDFTKMMKEGEDGELREAFVMYSGKSSREEGVITPKSLKKMLTRLGQSPTVNECTAMIGKFDVNGDGVLDFEEFRAMMN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G450450`
TK1151 ID	TkA05G450450
OH-1004 ID	LXL04_022206
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G450450

Location Chr05:112639680-112640699 (+)

Description Similar to CML38: Calcium-binding protein CML38

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76650`	Potential calcium sensor that binds calcium in vitro.	Developmental and stimulus-induced expression patterns of Arabidopsis calmodulin-like genes CML37, CML38 and CML39.2007 · DOI: 10.1007/s11103-007-9189-0
`At1g76640`	Potential calcium sensor that binds calcium in vitro.	Developmental and stimulus-induced expression patterns of Arabidopsis calmodulin-like genes CML37, CML38 and CML39.2007 · DOI: 10.1007/s11103-007-9189-0
`At3g50770`	Potential calcium sensor.	No verified direct reference in this release
`At5g42380`	Potential calcium sensor that binds calcium in vitro.	Developmental and stimulus-induced expression patterns of Arabidopsis calmodulin-like genes CML37, CML38 and CML39.2007 · DOI: 10.1007/s11103-007-9189-0

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0955400`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022206 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009611 response to wounding Biological Process

GO:0010193 response to ozone Biological Process

GO:0033198 response to ATP Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:1900459 positive regulation of brassinosteroid mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G76640

ath:AT1G76650

ath:AT3G50770

ath:AT5G42380

dosa:Os01g0955100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.326

Rank 1 · TkA05G450450 · TK1151

Nucleus0.260

Rank 2 · TkA05G450450 · TK1151

Endoplasmic reticulum0.138

Rank 3 · TkA05G450450 · TK1151

Cell membrane0.136

Rank 4 · TkA05G450450 · TK1151

Plastid0.135

Rank 5 · TkA05G450450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30551CFAP251_C32-70 aa

PF13517FG-GAP_333-54 aa

PF10591SPARC_Ca_bdg37-62 aa

PF12174RST37-71 aa

PF13499EF-hand_738-104 aa

PF13833EF-hand_838-64 aa

PF12763EH38-60 aa

PF00036EF-hand_139-66 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G450450	`PF30551`	CFAP251_C	32	70	0.095	13.1
TkA05G450450	`PF13517`	FG-GAP_3	33	54	0.023	16.0
TkA05G450450	`PF10591`	SPARC_Ca_bdg	37	62	0.17	12.9
TkA05G450450	`PF12174`	RST	37	71	0.32	11.6
TkA05G450450	`PF13499`	EF-hand_7	38	104	4.6e-26	91.7
TkA05G450450	`PF13833`	EF-hand_8	38	64	1.4e-21	76.7
TkA05G450450	`PF12763`	EH	38	60	3.1e-05	24.6
TkA05G450450	`PF00036`	EF-hand_1	39	66	1.1e-20	72.3
TkA05G450450	`PF13405`	EF-hand_6	39	68	1.6e-18	65.3
TkA05G450450	`PF23564`	EF-hand_FSTL1	39	105	1.7e-06	29.1
TkA05G450450	`PF30624`	EF_SSP120	40	59	0.08	14.3
TkA05G450450	`PF13202`	EF-hand_5	41	62	2.2e-17	62.4
TkA05G450450	`PF05042`	Caleosin	41	68	0.02	15.5
TkA05G450450	`PF21008`	AIF-1	42	126	1.5e-06	29.2
TkA05G450450	`PF14658`	EF-hand_9	43	104	4.6e-05	24.5
TkA05G450450	`PF00404`	Dockerin_1	45	56	0.019	15.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SRE6`	Arabidopsis thaliana	sp\|Q9SRE6\|CML38_ARATH Calcium-binding protein CML38	48.600%	Swiss-Prot	Medium
`Q9SRE7`	Arabidopsis thaliana	sp\|Q9SRE7\|CML39_ARATH Calcium-binding protein CML39	47.600%	Swiss-Prot	Medium
`Q8L3R2`	Arabidopsis thaliana	sp\|Q8L3R2\|CML41_ARATH Probable calcium-binding protein CML41	45.200%	Swiss-Prot	Medium
`Q9FIH9`	Arabidopsis thaliana	sp\|Q9FIH9\|CML37_ARATH Calcium-binding protein CML37	48.300%	Swiss-Prot	Medium
`Q8RYJ9`	Oryza sativa subsp. japonica	sp\|Q8RYJ9\|CML23_ORYSJ Putative calcium-binding protein CML23	45.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card