TkA05G442950 | RubberDandelionOmics

Gene overview

TkA05G442950

Reference: TK1151 Chr: Chr05 Coordinates: 110671238-110673557 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1649 bp · TkA05G442950|TK1151|cDNA

TAAGAGTTTCATTTCGCTTGTTTTACGCACCAGGTGGATCGTACCCTGTATCCCTCCCCTCCTCCGCTATTTCCCACCATCCGGCGAAGGCGTCACCGCCAGCGTTTGATCGCTCTACTTTGTATCATCGTCGCCGATTCGATGCAAAAAGTCAGAACACTCGCTTTCATCTTAAGTTCTTAATACACGATGTCGGTACACGATCAAGCAGCCGTCGCAGTCCTATCTCAAGTAGCCCTAGCCGCCGATGGCGCAGTTCT...

CDS

Download CDS FASTA

735 bp · TkA05G442950|TK1151|CDS

ATGTCGGTACACGATCAAGCAGCCGTCGCAGTCCTATCTCAAGTAGCCCTAGCCGCCGATGGCGCAGTTCTTGGTTTATCCTTAGCGTACATTGCAGTCCGCAGCCTCCTAAAGTTCAAGACGACCTCATCCGCCTTGAACAAAGTAAAAAAGGCACCTTCTGTAAGCGTCTCGGATCTCCGTTCTGTCCTCTCTCATGCTTCCGATGAAGATACAGACACGACTACTTTGAGTGATGAGAAGATCGTCATCGTTCGAGG...

Protein

Download Protein FASTA

244 aa · TkA05G442950|TK1151|PROTEIN

MSVHDQAAVAVLSQVALAADGAVLGLSLAYIAVRSLLKFKTTSSALNKVKKAPSVSVSDLRSVLSHASDEDTDTTTLSDEKIVIVRGVVETKSVVNGNWKKQNVLVSHESNEKAVILQRTQTCIYNEWRGFFGWTSDFRSLFARHWKEQESSSIRTVPFVLVDGGFWPQSDYLSVNLDGSNHPLPLTTVYHNLQPVTASPYTFLQAFFGHEYPVNPHIFYFMTSFYYSSYDLTFLLLLKVGTSG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G442950`
TK1151 ID	TkA05G442950
OH-1004 ID	LXL04_022048
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.100
Protein coverage (%)	TK1151 88.115 / OH-1004 54.987 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G442950

Location Chr05:110671238-110673557 (-)

Description Similar to SPL2: E3 ubiquitin-protein ligase SPL2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g54150`	Possesses E3 ubiquitin-protein ligase activity.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022048 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000209 protein polyubiquitination Biological Process

GO:0000266 mitochondrial fission Biological Process

GO:0009893 positive regulation of metabolic process Biological Process

GO:0010637 negative regulation of mitochondrial fusion Biological Process

GO:0010821 regulation of mitochondrion organization Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0016925 protein sumoylation Biological Process

GO:0031648 protein destabilization Biological Process

GO:0033235 positive regulation of protein sumoylation Biological Process

GO:0045824 negative regulation of innate immune response Biological Process

GO:0050689 negative regulation of defense response to virus by host Biological Process

GO:0050821 protein stabilization Biological Process

KEGG gene cross-reference

ath:AT1G54150

ath:AT1G59560

dme:Dmel_CG1134

hsa:79594

xla:414680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.348

Rank 1 · TkA05G442950 · TK1151

Nucleus0.253

Rank 2 · TkA05G442950 · TK1151

Cytoplasm0.202

Rank 3 · TkA05G442950 · TK1151

Mitochondrion0.192

Rank 4 · TkA05G442950 · TK1151

Golgi apparatus0.112

Rank 5 · TkA05G442950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12483GIDE140-213 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G442950	`PF12483`	GIDE	140	213	7e-13	49.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SYH3`	Arabidopsis thaliana	sp\|Q9SYH3\|SPL2P_ARATH E3 ubiquitin-protein ligase SPL2	46.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card