Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1364 bp · LXL04_022048|LXL04_022048|OH1004|cDNA
AAGAGTTTCATTTCGCTTGTTTTACGCACCAGGTGGATCGTACCCTGTATCCCTCCCCTCCTCCGCTATTTCCCACCATCCGGCGAAGGCGTCACCGCCAGCGTTTGATCGCTCTACTTTGTATCATCGTCGCCGATTCGATGCAAAAAGTCAGAACACTCGCTTTCATCTTAAGTTCTTAATACACGATGTCGGTACACGATCAAGCAGCCGTCGCAGTCCTATCTCAAGTAGCCCTAGCCGCCGATGGCGCAGTTCTT...
1176 bp · LXL04_022048|LXL04_022048|OH1004|CDS
ATGTCGGTACACGATCAAGCAGCCGTCGCAGTCCTATCTCAAGTAGCCCTAGCCGCCGATGGCGCAGTTCTTGGTTTATCCTTAGCGTACATTGCAGTCCGCAGCCTCCTAAAGTTCAAGACGACCTCATCCGCCTTGAACAAAGTAAAAAAGGCACCTTCTGTAAGCGTCTCGGATCTCCGTTTTGTCCTCTCTCATGCTTCCGATGAAGATACAGACACGACTACTTTGAGTGATGAGAAGATCGTCATCGTTCGAGG...
Protein
Download Protein FASTA391 aa · LXL04_022048|LXL04_022048|OH1004|PROTEIN
MSVHDQAAVAVLSQVALAADGAVLGLSLAYIAVRSLLKFKTTSSALNKVKKAPSVSVSDLRFVLSHASDEDTDTTTLSDEKIVIVRGVVETKSVVNGNWKKQNVLVSHESNEKAVILQRTQTCIYNEWRGFFGWTSDFRSLFARHWKEQESSSIRTVPFVLVDGGFWPQSDYLSVNLDGSNHPLPLTTVYHNLQPVTASPYTFLQAFFGHEYPVGLLDEEKILPVGKEISAVGLVSLKNGIPEVMACKDLPFFLSNMSKD...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_022048 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_022048 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:144024665-144026787 (-) | |||||||||
| Description | Similar to SPL2: E3 ubiquitin-protein ligase SPL2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000209 protein polyubiquitination Biological Process GO:0000266 mitochondrial fission Biological Process GO:0009893 positive regulation of metabolic process Biological Process GO:0010637 negative regulation of mitochondrial fusion Biological Process GO:0010821 regulation of mitochondrion organization Biological Process GO:0016567 protein ubiquitination Biological Process GO:0016925 protein sumoylation Biological Process GO:0031648 protein destabilization Biological Process GO:0033235 positive regulation of protein sumoylation Biological Process GO:0045824 negative regulation of innate immune response Biological Process GO:0050689 negative regulation of defense response to virus by host Biological Process GO:0050821 protein stabilization Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G54150 ath:AT1G59560 dme:Dmel_CG1134 hsa:79594 xla:414680 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12483.14GIDE140-287 aaPF13920.13zf-C3HC4_3336-384 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_022048 | PF12483.14 | GIDE | 140 | 287 | 8e-37 | 126.9 |
| LXL04_022048 | PF13920.13 | zf-C3HC4_3 | 336 | 384 | 1.5e-13 | 51.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.