Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1410 bp · TkA05G419620|TK1151|cDNA
AGAACAGTCTCGTGGACCGTGCCAACAGCCTCTCTTCTTGGTCCGGAAAAGATTGTTGCGGTTGGAATTCATGGTCATGGTCATTGTCATGGATCATATGACACTGACCATGAATTCCAAGAAGCGAAAAAACAAATGCTAGGAGGAATCATAAGTCATTCTTTGATCAAATTAGAGCAACTCCGGTACCTAGACTTGAGTTGCAACCATTTTGAACTGAGTTCGATCGCGTCATTCATTGGCTCTTTTCATAATATGAA...
1410 bp · TkA05G419620|TK1151|CDS
AGAACAGTCTCGTGGACCGTGCCAACAGCCTCTCTTCTTGGTCCGGAAAAGATTGTTGCGGTTGGAATTCATGGTCATGGTCATTGTCATGGATCATATGACACTGACCATGAATTCCAAGAAGCGAAAAAACAAATGCTAGGAGGAATCATAAGTCATTCTTTGATCAAATTAGAGCAACTCCGGTACCTAGACTTGAGTTGCAACCATTTTGAACTGAGTTCGATCGCGTCATTCATTGGCTCTTTTCATAATATGAA...
Protein
Download Protein FASTA469 aa · TkA05G419620|TK1151|PROTEIN
RTVSWTVPTASLLGPEKIVAVGIHGHGHCHGSYDTDHEFQEAKKQMLGGIISHSLIKLEQLRYLDLSCNHFELSSIASFIGSFHNMKYLNISNSRFSGEIPHFLGNLSSLVVLDVHDGNLRSQNLKGKMTWIKNLKQLQYLNMDGVNLTATSSDWLQAINNLRSLQELHFSSCGLTQIPSEPTRVSFTSLTLLDLSHNVFYGLLLGWVFSLRKLITLDLTGCLIGGLNPRTHGGFDTMPLLRSLRVSQNSFVNTSFFLND...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G419620 |
|---|---|
| TK1151 ID | TkA05G419620 |
| OH-1004 ID | LXL04_021765 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 96.500 |
| Protein coverage (%) | TK1151 43.070 / OH-1004 91.244Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G419620 | ||||||
|---|---|---|---|---|---|---|---|
| Location | Chr05:104515938-104517578 (+) | ||||||
| Description | Similar to EIX2: Receptor-like protein EIX2 | ||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||
| GO annotations (OH1004 source) | GO:0002220 innate immune response activating cell surface receptor signaling pathway Biological Process GO:0006898 receptor-mediated endocytosis Biological Process GO:0016045 detection of bacterium Biological Process GO:0042742 defense response to bacterium Biological Process GO:0050832 defense response to fungus Biological Process GO:0052544 defense response by callose deposition in cell wall Biological Process GO:0140426 pathogen-associated molecular pattern receptor signaling pathway Biological Process GO:0005768 endosome Cellular Component GO:0005886 plasma membrane Cellular Component GO:0010008 endosome membrane Cellular Component GO:0012505 endomembrane system Cellular Component GO:0016020 membrane Cellular Component | ||||||
| KEGG gene cross-reference | ath:AT5G46330 sly:543900 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF29594LRR_SKP250-174 aaPF23598LRR_1453-119 aaPF24758LRR_At5g5637054-99 aaPF12799LRR_455-71 aaPF25013LRR_Zer-155-154 aaPF23952LRR_EndoS56-93 aaPF13855LRR_860-117 aaPF00560LRR_160-79 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G419620 | PF29594 | LRR_SKP2 | 50 | 174 | 0.0086 | 16.1 |
| TkA05G419620 | PF23598 | LRR_14 | 53 | 119 | 6.9e-27 | 94.8 |
| TkA05G419620 | PF24758 | LRR_At5g56370 | 54 | 99 | 0.003 | 18.0 |
| TkA05G419620 | PF12799 | LRR_4 | 55 | 71 | 5.3e-25 | 87.6 |
| TkA05G419620 | PF25013 | LRR_Zer-1 | 55 | 154 | 7.2e-05 | 23.7 |
| TkA05G419620 | PF23952 | LRR_EndoS | 56 | 93 | 0.71 | 10.8 |
| TkA05G419620 | PF13855 | LRR_8 | 60 | 117 | 1e-28 | 99.6 |
| TkA05G419620 | PF00560 | LRR_1 | 60 | 79 | 2.6e-26 | 86.7 |
| TkA05G419620 | PF12799 | LRR_4 | 60 | 94 | 5.3e-25 | 87.6 |
| TkA05G419620 | PF13516 | LRR_6 | 61 | 71 | 9.9e-06 | 26.0 |
| TkA05G419620 | PF23211 | LRR_LRWD1 | 64 | 157 | 0.0033 | 17.9 |
| TkA05G419620 | PF25019 | LRR_R13L1-DRL21 | 66 | 116 | 1.1e-06 | 29.3 |
| TkA05G419620 | PF23247 | LRR_RPS2 | 81 | 174 | 3.1e-07 | 31.2 |
| TkA05G419620 | PF13516 | LRR_6 | 84 | 99 | 9.9e-06 | 26.0 |
| TkA05G419620 | PF00560 | LRR_1 | 85 | 107 | 2.6e-26 | 86.7 |
| TkA05G419620 | PF12799 | LRR_4 | 85 | 119 | 5.3e-25 | 87.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q9M9X0 | Arabidopsis thaliana | sp|Q9M9X0|RLP32_ARATH Receptor-like protein 32 | 29.700% | Swiss-Prot | Low |