LXL04_021765 | RubberDandelionOmics

Gene overview

LXL04_021765

Reference: OH-1004 Chr: Chr04 Coordinates: 136569157-136569810 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

654 bp · LXL04_021765|LXL04_021765|OH1004|cDNA

ATGAAATATCTTAACATCTCAAATTCGCGATTCTCTGGCGAAATTCCTCACTTTCTTGGAAATCTATCATCGTTGGTTGTTCTAGATGTTCATGACGGTAATCTTCGCTCCCAGAATTTAAAATGGATAAAGAATTTGAAGCAGTTGCAATACCTCAATATGGATGGGGTCAATCTCACTGCAGCCTCTTCAGATTGGCTTCAGGCGATAAACAATCTACGTTCATTGCAAGAACTACACTTTTCTTCATGTGGACTAAC...

CDS

Download CDS FASTA

654 bp · LXL04_021765|LXL04_021765|OH1004|CDS

ATGAAATATCTTAACATCTCAAATTCGCGATTCTCTGGCGAAATTCCTCACTTTCTTGGAAATCTATCATCGTTGGTTGTTCTAGATGTTCATGACGGTAATCTTCGCTCCCAGAATTTAAAATGGATAAAGAATTTGAAGCAGTTGCAATACCTCAATATGGATGGGGTCAATCTCACTGCAGCCTCTTCAGATTGGCTTCAGGCGATAAACAATCTACGTTCATTGCAAGAACTACACTTTTCTTCATGTGGACTAAC...

Protein

Download Protein FASTA

217 aa · LXL04_021765|LXL04_021765|OH1004|PROTEIN

MKYLNISNSRFSGEIPHFLGNLSSLVVLDVHDGNLRSQNLKWIKNLKQLQYLNMDGVNLTAASSDWLQAINNLRSLQELHFSSCGLTQIPSEPTRVSFTSLTLLDLSHNVFYGLLPGWVFSLRKLITLDLTGCLIGGLNPRTHGGFDTMPLLRSLRVSQNSFLNTSFFLNDLSSLTNLRYLDVSNCDLYDPILDKLHNLSLIVHLDESINQIVEEIP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021765`
TK1151 ID	TkA05G419620
OH-1004 ID	LXL04_021765
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.500
Protein coverage (%)	TK1151 43.070 / OH-1004 91.244 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021765

Location Chr04:136569157-136569810 (+)

Description Similar to EIX2: Receptor-like protein EIX2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g46330`	Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of flagellin (flg22), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs).	No verified direct reference in this release
`At1g80080`	Promotes cell fate progression in stomatal development.	No verified direct reference in this release
`At5g01890`	Leucine-rich repeat receptor-like protein kinase that may play a role in vascular tissues development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021765 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002220 innate immune response activating cell surface receptor signaling pathway Biological Process

GO:0006898 receptor-mediated endocytosis Biological Process

GO:0016045 detection of bacterium Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0052544 defense response by callose deposition in cell wall Biological Process

GO:0140426 pathogen-associated molecular pattern receptor signaling pathway Biological Process

GO:0005768 endosome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0010008 endosome membrane Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT5G46330

sly:543900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.754

Rank 1 · LXL04_021765 · OH-1004

Endoplasmic reticulum0.119

Rank 2 · LXL04_021765 · OH-1004

Nucleus0.085

Rank 3 · LXL04_021765 · OH-1004

Cytoplasm0.082

Rank 4 · LXL04_021765 · OH-1004

Extracellular0.030

Rank 5 · LXL04_021765 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598.2LRR_141-81 aa

PF13855.13LRR_82-56 aa

PF13855.13LRR_824-76 aa

PF23598.2LRR_1467-205 aa

PF13855.13LRR_874-135 aa

PF13855.13LRR_8100-161 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021765	`PF23598.2`	LRR_14	1	81	3.9e-15	56.2
LXL04_021765	`PF13855.13`	LRR_8	2	56	8.5e-17	61.4
LXL04_021765	`PF13855.13`	LRR_8	24	76	8.5e-17	61.4
LXL04_021765	`PF23598.2`	LRR_14	67	205	3.9e-15	56.2
LXL04_021765	`PF13855.13`	LRR_8	74	135	8.5e-17	61.4
LXL04_021765	`PF13855.13`	LRR_8	100	161	8.5e-17	61.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FL28`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase FLS2	29.224%	Swiss-Prot	weak database homology
`Q9SSD1`	Arabidopsis thaliana	Protein TOO MANY MOUTHS	29.493%	Swiss-Prot	weak database homology
`Q9LZV7`	Arabidopsis thaliana	Leucine-rich repeat receptor-like protein kinase PXC2	28.571%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card