Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3885 bp · TkA05G417820|TK1151|cDNA
TTGTTTGAAATAACGAAAGTACATGCGTACGTTGTTGGTTTAACATTCGTATCGGCGATGACCGTGGATGTGGAAGCAACTGCAAGCATGTTCAAGTCAAACTTCTCCGGGTTTATAATCGGTCACAATGCACATTAAAGAGGTTTGCTTAGAGGGATTCAAATCATACGCTACACGAACAGTTGTTCCAGGTTTCGATCCCTTTTTCAATGCCATAACCGGATTGAACGGGTCGGGAAAATCCAACATCCTCGACTCAA...
3528 bp · TkA05G417820|TK1151|CDS
ATGCACATTAAAGAGGTTTGCTTAGAGGGATTCAAATCATACGCTACACGAACAGTTGTTCCAGGTTTCGATCCCTTTTTCAATGCCATAACCGGATTGAACGGGTCGGGAAAATCCAACATCCTCGACTCAATTTGCTTCGTGCTAGGCATCACCAACTTACAGCAGGTTCGAGCTTCGAATCTACAGGAGCTGGTGTACAAGCAAGGACAAGCTGGAATCACGAAGGCGACAGTATCGGTTGTGTTTGATAACTCCGA...
Protein
Download Protein FASTA1175 aa · TkA05G417820|TK1151|PROTEIN
MHIKEVCLEGFKSYATRTVVPGFDPFFNAITGLNGSGKSNILDSICFVLGITNLQQVRASNLQELVYKQGQAGITKATVSVVFDNSDRSRSPLGFEDCPEITVTRQIVVGGRNKYLINGHLAQPSRVQNLFHSVQLNVNNPHFLIMQGRITKVLNMKPPEILSMLEEAAGTRMYETKKDAALKTLEKKQGKVDEINKLLDQEILPALEKLRKERMQYMQWSNGNAELDRLKRFCIAYEYVEAEKIRDSAVLGVDEVKGKI...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G417820 |
|---|---|
| TK1151 ID | TkA05G417820 |
| OH-1004 ID | LXL04_021737 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 97.400 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G417820 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:104017613-104030191 (+) | |||||||||
| Description | Similar to SMC2-1: Structural maintenance of chromosomes protein 2-1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000012 single strand break repair Biological Process GO:0007076 mitotic chromosome condensation Biological Process GO:0010032 meiotic chromosome condensation Biological Process GO:0030261 chromosome condensation Biological Process GO:0045132 meiotic chromosome segregation Biological Process GO:0048468 cell development Biological Process GO:0051301 cell division Biological Process GO:0051321 meiotic cell cycle Biological Process GO:0051383 kinetochore organization Biological Process GO:0051984 positive regulation of chromosome segregation Biological Process GO:1905820 positive regulation of chromosome separation Biological Process GO:1905821 positive regulation of chromosome condensation Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT3G47460 ath:AT5G62410 hsa:10592 mmu:14211 xla:397800 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF02463SMC_N2-1161 aaPF13304AAA_2127-54 aaPF13166AAA_1327-41 aaPF13555AAA_2929-49 aaPF00005ABC_tran29-49 aaPF17675APG6_N171-219 aaPF19220Rod_CreS171-290 aaPF24161CCDC39173-217 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G417820 | PF02463 | SMC_N | 2 | 1161 | 1.4e-58 | 198.7 |
| TkA05G417820 | PF13304 | AAA_21 | 27 | 54 | 2e-10 | 41.9 |
| TkA05G417820 | PF13166 | AAA_13 | 27 | 41 | 3.8 | 6.8 |
| TkA05G417820 | PF13555 | AAA_29 | 29 | 49 | 0.0044 | 17.5 |
| TkA05G417820 | PF00005 | ABC_tran | 29 | 49 | 0.067 | 14.5 |
| TkA05G417820 | PF17675 | APG6_N | 171 | 219 | 0.015 | 16.5 |
| TkA05G417820 | PF19220 | Rod_CreS | 171 | 290 | 0.7 | 9.7 |
| TkA05G417820 | PF24161 | CCDC39 | 173 | 217 | 0.0001 | 21.0 |
| TkA05G417820 | PF23991 | DUF7310 | 179 | 209 | 1.4 | 10.2 |
| TkA05G417820 | PF23649 | FKBP15 | 182 | 202 | 0.0028 | 18.0 |
| TkA05G417820 | PF13304 | AAA_21 | 183 | 226 | 2e-10 | 41.9 |
| TkA05G417820 | PF23735 | KIF9 | 187 | 218 | 0.0019 | 19.1 |
| TkA05G417820 | PF17675 | APG6_N | 209 | 285 | 0.015 | 16.5 |
| TkA05G417820 | PF28907 | ZapB_rel | 253 | 285 | 0.024 | 16.0 |
| TkA05G417820 | PF23991 | DUF7310 | 253 | 303 | 1.4 | 10.2 |
| TkA05G417820 | PF24161 | CCDC39 | 254 | 502 | 0.0001 | 21.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.