TkA05G414340 | RubberDandelionOmics

Gene overview

TkA05G414340

Reference: TK1151 Chr: Chr05 Coordinates: 103091946-103106164 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4502 bp · TkA05G414340|TK1151|cDNA

GGTAACGTGTGACGCAATGGACCAAGAGATAGGATGCCATATGGAAACTTGAATCGTATCGAATTGAACTAACTGGTAAGGACAATATCCAAAACCACCGCAACCAACAACCAATCCCGACGAGCGGTGGCGTGTCGCCTTTCACCACCGGCATCCTCCGTCACCACACACTAAATTACAAAAACACCCTTCTATAAAGTAATGCAAACGGCATGTTTATTTAAAGGCCCGTACGTGTCAAAATACCAATCATTTTCTCC...

CDS

Download CDS FASTA

4086 bp · TkA05G414340|TK1151|CDS

ATGCAAACGGCATGTTTATTTAAAGGCCCGTACGTGTCAAAATACCAATCATTTTCTCCGCCGTTTCTCTCTCCTCCTCCTCGTGGAGTACTCATCACGCCCAAAAGTAGAACCAGAAACACTACCACCAGTGGGAAGAGTTTTGTAATTAGGGCAATGCCTGATTCTTCTTCTTCTTCTTCGCCTGAAATCGATAACAATGGCGCGTTGCGTAAGTTCAAGCTGAACGAGTCGTCGTTTTTGGCTTCTCTGATGCCGAA...

Protein

Download Protein FASTA

1361 aa · TkA05G414340|TK1151|PROTEIN

MQTACLFKGPYVSKYQSFSPPFLSPPPRGVLITPKSRTRNTTTSGKSFVIRAMPDSSSSSSPEIDNNGALRKFKLNESSFLASLMPKKEIGADRFIEAHPEFDGRGVVIAIFDSGVDPAAAGLQVTTDGRPKVIDVIDCTGSGDIDTSTVVKADANNCIRGASGASLIINPSWKNPSGDWHVGYKLVYELLTDTLISRLKKERRKKWDEKNQEAIAVAVKQLEEFEKKQTKADELSSKKTREDLQDRVDYLKKQSDSYDD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G414340`
TK1151 ID	TkA05G414340
OH-1004 ID	LXL04_021657
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	45.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G414340

Location Chr05:103091946-103106164 (+)

Description Similar to TPP2: Tripeptidyl-peptidase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g20850`	Serine protease of the proteasome pathway that may function with the 20S proteasome to degrade oxidized proteins generated by environmental stress.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0664300`	Serine protease that may function in the proteasome pathway.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021657 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000209 protein polyubiquitination Biological Process

GO:0006508 proteolysis Biological Process

GO:0080144 intracellular amino acid homeostasis Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016604 nuclear body Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0004175 endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT4G20850

dosa:Os02g0664300

hsa:7174

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.858

Rank 1 · TkA05G414340 · TK1151

Mitochondrion0.092

Rank 2 · TkA05G414340 · TK1151

Cytoplasm0.083

Rank 3 · TkA05G414340 · TK1151

Peroxisome0.051

Rank 4 · TkA05G414340 · TK1151

Nucleus0.038

Rank 5 · TkA05G414340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00082Peptidase_S8104-563 aa

PF07362CcdA190-217 aa

PF12583TPPII_C200-228 aa

PF21223TPPII_Ig-like-1612-721 aa

PF21316TPPII_GBD741-825 aa

PF12580TPPII868-1052 aa

PF12583TPPII_C1106-1173 aa

PF21223TPPII_Ig-like-11314-1348 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G414340	`PF00082`	Peptidase_S8	104	563	2.8e-44	152.3
TkA05G414340	`PF07362`	CcdA	190	217	0.19	12.8
TkA05G414340	`PF12583`	TPPII_C	200	228	9.2	7.7
TkA05G414340	`PF21223`	TPPII_Ig-like-1	612	721	8.2e-24	84.9
TkA05G414340	`PF21316`	TPPII_GBD	741	825	2.8e-15	57.0
TkA05G414340	`PF12580`	TPPII	868	1052	1.3e-65	221.2
TkA05G414340	`PF12583`	TPPII_C	1106	1173	9.2	7.7
TkA05G414340	`PF21223`	TPPII_Ig-like-1	1314	1348	8.2e-24	84.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JVN6`	Arabidopsis thaliana	sp\|F4JVN6\|TPPII_ARATH Tripeptidyl-peptidase 2	69.100%	Swiss-Prot	High
`Q6ESI7`	Oryza sativa subsp. japonica	sp\|Q6ESI7\|TPPII_ORYSJ Tripeptidyl-peptidase 2	65.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card