Gene Card
Gene overview
cDNA / CDS / Protein Sequences
8856 bp · LXL04_021657|LXL04_021657|OH1004|cDNA
ATGCAAACGGCATGTTTATTTAAAGGCCCGTACGTGTCAAAATACCAATCATTTTCTCCGCCGTTTCTCTCTCCTCCTCCTCGTGGAGTACTCATCACGCCCAAAAGTAGAACCAGAAACACTACCACCAGTGGGAAGAGTTTTGTAATTAGGGCAATGCctgattcttcttcttcttcttcgccTGAAATCGATAACAATGGCGCGTTGCGTAAGTTCAAGCTGAACGAGTCGTCGTTTTTGGCTTCTCTGATGCCGAA...
8856 bp · LXL04_021657|LXL04_021657|OH1004|CDS
ATGCAAACGGCATGTTTATTTAAAGGCCCGTACGTGTCAAAATACCAATCATTTTCTCCGCCGTTTCTCTCTCCTCCTCCTCGTGGAGTACTCATCACGCCCAAAAGTAGAACCAGAAACACTACCACCAGTGGGAAGAGTTTTGTAATTAGGGCAATGCCTGATTCTTCTTCTTCTTCTTCGCCTGAAATCGATAACAATGGCGCGTTGCGTAAGTTCAAGCTGAACGAGTCGTCGTTTTTGGCTTCTCTGATGCCGAA...
Protein
Download Protein FASTA2951 aa · LXL04_021657|LXL04_021657|OH1004|PROTEIN
MQTACLFKGPYVSKYQSFSPPFLSPPPRGVLITPKSRTRNTTTSGKSFVIRAMPDSSSSSSPEIDNNGALRKFKLNESSFLASLMPKKEIGADRFIEAHPEFDGRGVVIAIFGTYLTVFDYSLVLVISDNRNENRIYSGVDPAAAGLQVTTDGRPKVIDVIDCTGSGDIDTSTVVKADANNCIRGASGASLIINPSWKNPSGDWHVGYKLVYELLTDTLISRLKKERRKKWDEKNQEAIAVAVKQLEEFEKVAVQKQTKA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_021657 |
|---|---|
| TK1151 ID | TkA05G414340 |
| OH-1004 ID | LXL04_021657 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 45.500 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_021657 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:134333396-134352230 (+) | ||||||||||||
| Description | Similar to TPP2: Tripeptidyl-peptidase 2 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0000209 protein polyubiquitination Biological Process GO:0006508 proteolysis Biological Process GO:0080144 intracellular amino acid homeostasis Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005773 vacuole Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0016604 nuclear body Cellular Component GO:0022626 cytosolic ribosome Cellular Component GO:0003729 mRNA binding Molecular Function GO:0004175 endopeptidase activity Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT4G20850 dosa:Os02g0664300 hsa:7174 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00082.28Peptidase_S8344-591 aaPF21223.4TPPII_Ig-like-1640-748 aaPF21316.4TPPII_GBD768-852 aaPF12580.15TPPII895-990 aaPF03732.25PEG10_N-capsid1107-1178 aaPF19259.5Ty3_capsid1124-1256 aaPF13975.12gag-asp_proteas1413-1503 aaPF13650.12Asp_protease_21413-1498 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_021657 | PF00082.28 | Peptidase_S8 | 344 | 591 | 7.7e-40 | 137.7 |
| LXL04_021657 | PF21223.4 | TPPII_Ig-like-1 | 640 | 748 | 3.9e-23 | 82.7 |
| LXL04_021657 | PF21316.4 | TPPII_GBD | 768 | 852 | 4.2e-14 | 53.2 |
| LXL04_021657 | PF12580.15 | TPPII | 895 | 990 | 7.3e-60 | 202.4 |
| LXL04_021657 | PF03732.25 | PEG10_N-capsid | 1107 | 1178 | 2.5e-08 | 34.9 |
| LXL04_021657 | PF19259.5 | Ty3_capsid | 1124 | 1256 | 1.5e-11 | 44.8 |
| LXL04_021657 | PF13975.12 | gag-asp_proteas | 1413 | 1503 | 1.9e-07 | 32.3 |
| LXL04_021657 | PF13650.12 | Asp_protease_2 | 1413 | 1498 | 4.7e-07 | 31.1 |
| LXL04_021657 | PF08284.17 | RVP_2 | 1415 | 1504 | 5e-11 | 43.3 |
| LXL04_021657 | PF30863.1 | PRO_PEG10-RTL1 | 1423 | 1521 | 5.3e-12 | 46.9 |
| LXL04_021657 | PF00078.33 | RVT_1 | 1647 | 1807 | 7.1e-36 | 124.7 |
| LXL04_021657 | PF17919.8 | RT_RNaseH_2 | 1869 | 1963 | 9.6e-30 | 103.3 |
| LXL04_021657 | PF17917.8 | RT_RNaseH | 1894 | 1993 | 8.2e-28 | 97.3 |
| LXL04_021657 | PF17921.8 | Integrase_H2C2 | 2084 | 2137 | 1.2e-17 | 64.4 |
| LXL04_021657 | PF00665.33 | rve | 2161 | 2251 | 3.2e-06 | 28.0 |
| LXL04_021657 | PF24626.2 | SH3_Tf2-1 | 2368 | 2432 | 4e-22 | 78.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.