TkA05G409030 | RubberDandelionOmics

Gene overview

TkA05G409030

Reference: TK1151 Chr: Chr05 Coordinates: 101709143-101717415 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1038 bp · TkA05G409030|TK1151|cDNA

ATGGAAGATGAAGAAGAAGACGAAGGTGTCGTCAATTCGCACCCCAGGACACGGCAGCCGATTCCTAGGGACCGTGTGGGTGCTCACAACCGTCTGGTAGGACACTACTTCGCCCCCAATTCTGTTTACCCACTGTCTGTATTCCGTCGTCGTTTTCGAATGCATAAACATTTGTTCCTTCGCATTCTCAACGACGTGACGACTAAATCACACTATATGCAGCAACGGTCAGATTGCACGGGTAAGCGGACTGCCGTAGA...

CDS

Download CDS FASTA

1038 bp · TkA05G409030|TK1151|CDS

ATGGAAGATGAAGAAGAAGACGAAGGTGTCGTCAATTCGCACCCCAGGACACGGCAGCCGATTCCTAGGGACCGTGTGGGTGCTCACAACCGTCTGGTAGGACACTACTTCGCCCCCAATTCTGTTTACCCACTGTCTGTATTCCGTCGTCGTTTTCGAATGCATAAACATTTGTTCCTTCGCATTCTCAACGACGTGACGACTAAATCACACTATATGCAGCAACGGTCAGATTGCACGGGTAAGCGGACTGCCGTAGA...

Protein

Download Protein FASTA

345 aa · TkA05G409030|TK1151|PROTEIN

MEDEEEDEGVVNSHPRTRQPIPRDRVGAHNRLVGHYFAPNSVYPLSVFRRRFRMHKHLFLRILNDVTTKSHYMQQRSDCTGKRTAVESLDEFCRCIIELYWDRYMRTPTPSDVQALYAHHSQHHGLPGMLGSLDCLHWEWDGCRVANHGQYAHGNKKHATMILEAVASQDLWFWHCYFGLAGSNNDLNVLQMSPIFNHILNGTAPDTSFQLNAVTERFKRAQERARKNIERAFGALKQRWGILKGGARSSDRDKIAKVMY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G409030`
TK1151 ID	TkA05G409030
OH-1004 ID	LXL04_013205
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	71.200
Protein coverage (%)	TK1151 98.841 / OH-1004 69.043 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G409030

Location Chr05:101709143-101717415 (+)

Description Similar to At3g55350: Protein ALP1-like

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g55350`	Transposase-derived protein that may have nuclease activity.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013205 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0000118 histone deacetylase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0035098 ESC/E(Z) complex Cellular Component

GO:0035102 PRC1 complex Cellular Component

GO:0003682 chromatin binding Molecular Function

GO:0004518 nuclease activity Molecular Function

GO:0016787 hydrolase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G55350

ath:AT3G63270

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.900

Rank 1 · TkA05G409030 · TK1151

Cytoplasm0.238

Rank 2 · TkA05G409030 · TK1151

Cell membrane0.021

Rank 3 · TkA05G409030 · TK1151

Mitochondrion0.021

Rank 4 · TkA05G409030 · TK1151

Endoplasmic reticulum0.016

Rank 5 · TkA05G409030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28509DUF841829-67 aa

PF26138DUF804048-76 aa

PF01609DDE_Tnp_150-89 aa

PF04827Plant_tran103-213 aa

PF13359DDE_Tnp_4133-267 aa

PF28509DUF8418194-201 aa

PF26138DUF8040211-235 aa

PF04827Plant_tran217-275 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G409030	`PF28509`	DUF8418	29	67	4.6e-17	62.2
TkA05G409030	`PF26138`	DUF8040	48	76	0.47	11.1
TkA05G409030	`PF01609`	DDE_Tnp_1	50	89	0.027	15.0
TkA05G409030	`PF04827`	Plant_tran	103	213	1.5e-57	195.2
TkA05G409030	`PF13359`	DDE_Tnp_4	133	267	2.6e-14	53.9
TkA05G409030	`PF28509`	DUF8418	194	201	4.6e-17	62.2
TkA05G409030	`PF26138`	DUF8040	211	235	0.47	11.1
TkA05G409030	`PF04827`	Plant_tran	217	275	1.5e-57	195.2
TkA05G409030	`PF12644`	DUF3782	217	243	0.26	12.2
TkA05G409030	`PF01609`	DDE_Tnp_1	224	267	0.027	15.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2U3`	Arabidopsis thaliana	sp\|Q9M2U3\|ALPL_ARATH Protein ALP1-like	25.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card