Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2176 bp · TkA05G400900|TK1151|cDNA
TGGAAAGCCCAAAGAATCGAGACCAAGGGCAGTTTACGGGTTACCCGACTGGCGACAGTAGTCGGGGATGATGCCTGTTATTTCCATTGGTCAAGCGATTCTCCGGCGCCTCTCCACCGTCGACGACCTTTTCCGCCATGGCGACGAGGAAGCTATCGCTATCGAAGCTTCTCCGCTGCCGCTACCACACCCTTCGTACTACCCCTTCAACATCATCAATATCTAATTATACTTTCCCTCCTTCTTCAATCAAACCCCAG...
1737 bp · TkA05G400900|TK1151|CDS
ATGGCGACGAGGAAGCTATCGCTATCGAAGCTTCTCCGCTGCCGCTACCACACCCTTCGTACTACCCCTTCAACATCATCAATATCTAATTATACTTTCCCTCCTTCTTCAATCAAACCCCAGCATTTCTCTAATTCATTCAATCGCAATTTAGCTACACATAACTTTTATGGACACGGTGAAGGCATTAGATTTTGGAGACCGTACAAGTTCTCATTAGCACCATCATCTAATCGTTCCTTTTCGACTGATAGAGAAAA...
Protein
Download Protein FASTA578 aa · TkA05G400900|TK1151|PROTEIN
MATRKLSLSKLLRCRYHTLRTTPSTSSISNYTFPPSSIKPQHFSNSFNRNLATHNFYGHGEGIRFWRPYKFSLAPSSNRSFSTDREKATDGPVDEELLGTGFFDYNYGGGGDVGIPGEITDAVIRGEEVILPVRCLVWFLDKVHDLTGMPWWTVIIISTLALRVAILPVLLLQLQKLKINAELAPKLPPPLPPPFSGKSWIKQYKLFTEKRKELGCPTFLWILAYPSVQIPCFILGTSSVRQMALDHHSGFETGGTLWFQ...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G400900 |
|---|---|
| TK1151 ID | TkA05G400900 |
| OH-1004 ID | LXL04_026347 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 25.000 |
| Protein coverage (%) | TK1151 42.042 / OH-1004 51.528Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G400900 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:99735229-99739051 (-) | |||||||||
| Description | Similar to OXA1: Mitochondrial inner membrane protein OXA1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009060 aerobic respiration Biological Process GO:0032543 mitochondrial translation Biological Process GO:0032780 negative regulation of ATP-dependent activity Biological Process GO:0032979 protein insertion into mitochondrial inner membrane from matrix Biological Process GO:0032981 mitochondrial respiratory chain complex I assembly Biological Process GO:0033615 mitochondrial proton-transporting ATP synthase complex assembly Biological Process GO:0045039 protein insertion into mitochondrial inner membrane Biological Process GO:0051262 protein tetramerization Biological Process GO:0051354 negative regulation of oxidoreductase activity Biological Process GO:0065003 protein-containing complex assembly Biological Process GO:0141164 mitochondrial protein quality control Biological Process GO:0005739 mitochondrion Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT2G46470 ath:AT5G62050 bta:520335 hsa:5018 mmu:69089 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF0209660KD_IMP144-187 aaPF0209660KD_IMP229-351 aaPF07719TPR_2400-430 aaPF13431TPR_17400-416 aaPF24575TPR_Slam401-452 aaPF13432TPR_16407-459 aaPF25063ARM_TT21_C408-457 aaPF13428TPR_14409-440 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G400900 | PF02096 | 60KD_IMP | 144 | 187 | 5.9e-09 | 36.7 |
| TkA05G400900 | PF02096 | 60KD_IMP | 229 | 351 | 5.9e-09 | 36.7 |
| TkA05G400900 | PF07719 | TPR_2 | 400 | 430 | 1.5e-08 | 34.8 |
| TkA05G400900 | PF13431 | TPR_17 | 400 | 416 | 0.12 | 13.4 |
| TkA05G400900 | PF24575 | TPR_Slam | 401 | 452 | 0.3 | 12.2 |
| TkA05G400900 | PF13432 | TPR_16 | 407 | 459 | 1.2e-06 | 29.5 |
| TkA05G400900 | PF25063 | ARM_TT21_C | 408 | 457 | 0.0095 | 16.5 |
| TkA05G400900 | PF13428 | TPR_14 | 409 | 440 | 2e-06 | 28.6 |
| TkA05G400900 | PF14559 | TPR_19 | 409 | 457 | 8.4e-06 | 26.7 |
| TkA05G400900 | PF13176 | TPR_7 | 409 | 429 | 6.1e-05 | 23.5 |
| TkA05G400900 | PF00515 | TPR_1 | 409 | 430 | 0.00012 | 22.4 |
| TkA05G400900 | PF13181 | TPR_8 | 409 | 429 | 0.00015 | 22.3 |
| TkA05G400900 | PF29386 | CFAP70_mid_TPR | 409 | 483 | 0.001 | 20.0 |
| TkA05G400900 | PF29407 | CFAP70_TPR_C | 409 | 461 | 0.28 | 11.3 |
| TkA05G400900 | PF29814 | TPR_Myxo | 409 | 457 | 0.33 | 12.1 |
| TkA05G400900 | PF13174 | TPR_6 | 410 | 429 | 0.00046 | 21.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.