TkA05G399150 | RubberDandelionOmics

Gene overview

TkA05G399150

Reference: TK1151 Chr: Chr05 Coordinates: 99253387-99257277 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3059 bp · TkA05G399150|TK1151|cDNA

CAAGAATCAAGAACAGCTTCGAGTCCTCCACTTCGATTAGGGCTCCATTTTATTGGTTCTCGTTGCCGAGTTTGATAGGGCTCCATTCTTCTCTGTTACGATACCCATAGGTACGAGCTTGCCACTGAAACTCGTCTCGGATTCCAGGGGTTCCAATTCCCTTCGCCGATTGAAATTCGTCCTATCGTCGCCGATTGACACTCATCGCCGGTGGAAATCATCACCGATTGGAGATTGCATCTCGTTCTCTCATCACCGAT...

CDS

Download CDS FASTA

1992 bp · TkA05G399150|TK1151|CDS

ATGGGTAGCCAAGGCTTTAATAGTCAAACAAATCCCCCAAGATTGGGCATCACAGAGCCAATATCTTTAGGGGGCCCAACCGAGTATGATATAATAAAGACCAACGAGCTTGAAAAGTTTCTAGCTGATGCTGGACTATATGAGAGTCAGGAAGAAGCCATAAGCAGGGAAGAGGTTTTGGGACGTCTAGACCAGATTGTGAAAATGTGGGTGAAAAAAGTTAGCCGTGCCAGGGGGTTAAATGAGCAGCTGGTTCAGGA...

Protein

Download Protein FASTA

663 aa · TkA05G399150|TK1151|PROTEIN

MGSQGFNSQTNPPRLGITEPISLGGPTEYDIIKTNELEKFLADAGLYESQEEAISREEVLGRLDQIVKMWVKKVSRARGLNEQLVQEANAKIFTFGSYRLGVHGPGADIDTLCVGPRHASRDEDFFGELKRMLSDMADVTELHPVPDAHVPVMKFKLNGVSIDLLYAKLSLWVIPEDLDISQDSILQNADEQSVRSLNGCRVTDQILRLVPNIQSFRTTLRCMRFWAKRRGVYSNVAGFLGGINWALLVARICQLYPNAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G399150`
TK1151 ID	TkA05G399150
OH-1004 ID	LXL04_032156
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	62.900
Protein coverage (%)	TK1151 73.605 / OH-1004 87.609 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G399150

Location Chr05:99253387-99257277 (+)

Description Similar to PAPS4: Nuclear poly(A) polymerase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17980`	Essential protein.	No verified direct reference in this release
`At4g32850`	Essential protein.	No verified direct reference in this release
`At2g25850`	Essential protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032156 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009908 flower development Biological Process

GO:0031123 RNA 3'-end processing Biological Process

GO:0031124 mRNA 3'-end processing Biological Process

GO:0045824 negative regulation of innate immune response Biological Process

GO:0048366 leaf development Biological Process

GO:0048451 petal formation Biological Process

GO:0180010 co-transcriptional mRNA 3'-end processing, cleavage and polyadenylation pathway Biological Process

GO:0180011 cytosolic mRNA polyadenylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G17980

ath:AT2G25850

ath:AT4G32850

ddi:DDB_G0288259

mmu:18789

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.804

Rank 1 · TkA05G399150 · TK1151

Cytoplasm0.231

Rank 2 · TkA05G399150 · TK1151

Cell membrane0.046

Rank 3 · TkA05G399150 · TK1151

Endoplasmic reticulum0.029

Rank 4 · TkA05G399150 · TK1151

Mitochondrion0.020

Rank 5 · TkA05G399150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20750PAP_NTPase16-210 aa

PF01909NTP_transf_282-159 aa

PF22600MTPAP-like_central89-163 aa

PF04928PAP_central215-356 aa

PF04926PAP_RNA-bind360-417 aa

PF22600MTPAP-like_central363-377 aa

PF04926PAP_RNA-bind419-490 aa

PF04926PAP_RNA-bind563-603 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G399150	`PF20750`	PAP_NTPase	16	210	2.9e-80	269.4
TkA05G399150	`PF01909`	NTP_transf_2	82	159	9.7e-11	42.6
TkA05G399150	`PF22600`	MTPAP-like_central	89	163	0.00025	21.8
TkA05G399150	`PF04928`	PAP_central	215	356	1.6e-66	223.3
TkA05G399150	`PF04926`	PAP_RNA-bind	360	417	4.6e-21	76.0
TkA05G399150	`PF22600`	MTPAP-like_central	363	377	0.00025	21.8
TkA05G399150	`PF04926`	PAP_RNA-bind	419	490	4.6e-21	76.0
TkA05G399150	`PF04926`	PAP_RNA-bind	563	603	4.6e-21	76.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LMT2`	Arabidopsis thaliana	sp\|Q9LMT2\|PAPS1_ARATH Nuclear poly(A) polymerase 1	59.400%	Swiss-Prot	High
`Q8VYW1`	Arabidopsis thaliana	sp\|Q8VYW1\|PAPS4_ARATH Nuclear poly(A) polymerase 4	65.500%	Swiss-Prot	High
`O82312`	Arabidopsis thaliana	sp\|O82312\|PAPS2_ARATH Nuclear poly(A) polymerase 2	62.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card