LXL04_032156 | RubberDandelionOmics

Gene overview

LXL04_032156

Reference: OH-1004 Chr: Chr07 Coordinates: 17645521-17649113 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1736 bp · LXL04_032156|LXL04_032156|OH1004|cDNA

ATGGTGGGCGCCGACGCTTTACCTTCTCCGAGGCAGCACGGTGTTACCAAACCGCTGTCTCTAGCGGGGCCATCGGAGGCCGATTTACTCAGAACTAAAAAGTTGAATGAGTTCCTGGTAGATGCTGGACTTTATGAAAGTCAAGATGAAACCGCCAAGAGGGAGGAGGTTCTAGGTCGAATCAAGCAGGTTCTTGCGATTACTCTTGCTCAACTTATAATTGTAATTGATTGGGTGAAACAACTCACACGCCTTCGAGG...

CDS

Download CDS FASTA

1722 bp · LXL04_032156|LXL04_032156|OH1004|CDS

ATGGTGGGCGCCGACGCTTTACCTTCTCCGAGGCAGCACGGTGTTACCAAACCGCTGTCTCTAGCGGGGCCATCGGAGGCCGATTTACTCAGAACTAAAAAGTTGAATGAGTTCCTGGTAGATGCTGGACTTTATGAAAGTCAAGATGAAACCGCCAAGAGGGAGGAGGTTCTAGGTCGAATCAAGCAGGTTCTTGCGATTACTCTTGCTCAACTTATAATTGTAATTGATTGGGTGAAACAACTCACACGCCTTCGAGG...

Protein

Download Protein FASTA

573 aa · LXL04_032156|LXL04_032156|OH1004|PROTEIN

MVGADALPSPRQHGVTKPLSLAGPSEADLLRTKKLNEFLVDAGLYESQDETAKREEVLGRIKQVLAITLAQLIIVIDWVKQLTRLRGYTEQMVEDANAVIFTFGSYRLGVHGPGADIDTLCVGPSYVNRNEDFFFVLHDILTNMEEVTELQPVPDAHVPVMKFKFEGISIDLLYASISRLVVPDDLDISDVSVLHNVDEPTVRSLNGCRVADQILKHVPNIEHFRTTLRCLKFWAKRRGVYSNVTGFLGGVNWALLVARV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032156`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032156

Location Chr07:17645521-17649113 (+)

Description Similar to PAPS4: Nuclear poly(A) polymerase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g32850`	Essential protein.	No verified direct reference in this release
`At2g25850`	Essential protein.	No verified direct reference in this release
`At1g17980`	Essential protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032156 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009908 flower development Biological Process

GO:0031123 RNA 3'-end processing Biological Process

GO:0031124 mRNA 3'-end processing Biological Process

GO:0045824 negative regulation of innate immune response Biological Process

GO:0048366 leaf development Biological Process

GO:0048451 petal formation Biological Process

GO:0180010 co-transcriptional mRNA 3'-end processing, cleavage and polyadenylation pathway Biological Process

GO:0180011 cytosolic mRNA polyadenylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G17980

ath:AT2G25850

ath:AT4G32850

ddi:DDB_G0288259

mmu:18789

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.716

Rank 1 · LXL04_032156 · OH-1004

Cytoplasm0.350

Rank 2 · LXL04_032156 · OH-1004

Cell membrane0.048

Rank 3 · LXL04_032156 · OH-1004

Mitochondrion0.040

Rank 4 · LXL04_032156 · OH-1004

Endoplasmic reticulum0.036

Rank 5 · LXL04_032156 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20750.4PAP_NTPase14-218 aa

PF01909.30NTP_transf_285-172 aa

PF04928.23PAP_central223-367 aa

PF04926.21PAP_RNA-bind371-426 aa

PF04926.21PAP_RNA-bind437-503 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032156	`PF20750.4`	PAP_NTPase	14	218	1.3e-70	237.9
LXL04_032156	`PF01909.30`	NTP_transf_2	85	172	4.6e-10	40.5
LXL04_032156	`PF04928.23`	PAP_central	223	367	1.4e-68	230.0
LXL04_032156	`PF04926.21`	PAP_RNA-bind	371	426	3.8e-19	69.8
LXL04_032156	`PF04926.21`	PAP_RNA-bind	437	503	3.8e-19	69.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYW1`	Arabidopsis thaliana	Nuclear poly(A) polymerase 4	70.758%	Swiss-Prot	strong database homology
`O82312`	Arabidopsis thaliana	Nuclear poly(A) polymerase 2	68.126%	Swiss-Prot	strong database homology
`Q9LMT2`	Arabidopsis thaliana	Nuclear poly(A) polymerase 1	61.386%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card