TkA05G392220 | RubberDandelionOmics

Gene overview

TkA05G392220

Reference: TK1151 Chr: Chr05 Coordinates: 97484378-97495234 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1424 bp · TkA05G392220|TK1151|cDNA

TTTAAATATCAGAAAATCCAAAATCCAAAAACAAATTCTTTATTCTTTATATAAGAAAATCCAAAAAAGTGTTGTTTGAGTATGTGTGTAGGATTCTATGCACTATAGCTCAGGGGGAAGGGGAAAATTCTTTGGTTGAGGGGGAGAAATGTGAATCGTCAGTTAGGGGGAGCAATTAACTATTTATTTGCTTATTGATTTCAGGTACTTGTACCAACTGTGAAATCATCAACTGATGATGGAATAAGGGATTGATGGTG...

CDS

Download CDS FASTA

714 bp · TkA05G392220|TK1151|CDS

ATGGATTCAGCCGGGAGAATTAGTCAAATAATTCAGTCAAAGCTCTCTACCACTGTTGCTAGCGGTAATTTTCTTGCAGCCAAGAAAAGAGGAGTAGTTGAAGGCATAGATTATAAATCAACAGGCGAAGTAAAGAAAATAGACGTTTCACGTATCCGTGAAATGCTTGATAGCGACTCTATTGTAATTTTAAGCAACATTGGACATTCAAGCTCTGGAGAAATATTAAATTGCAACACGTATGAAGTTGCGACAGCTTG...

Protein

Download Protein FASTA

237 aa · TkA05G392220|TK1151|PROTEIN

MDSAGRISQIIQSKLSTTVASGNFLAAKKRGVVEGIDYKSTGEVKKIDVSRIREMLDSDSIVILSNIGHSSSGEILNCNTYEVATACAMAIGAEKLICIINGSILDEMGHVIRFLSLEDVDRFKKIEIATNYVNVIGDEDRNNSDSNSRCSARFRNGIGFDFDHGNLSELASVCRGGVERVHLVDGNISGVLLKELFQKDGIGTLVASDLYEGTKAVKVTDLPAIRQNLRPLRVSGT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G392220`
TK1151 ID	TkA05G392220
OH-1004 ID	LXL04_013628
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	52.100
Protein coverage (%)	TK1151 100.000 / OH-1004 49.048 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G392220

Location Chr05:97484378-97495234 (-)

Description Similar to NAGS2: Probable amino-acid acetyltransferase NAGS2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g22910`	N-acetylglutamate synthase involved in arginine biosynthesis.	No verified direct reference in this release
`At4g37670`	N-acetylglutamate synthase involved in arginine biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013628 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006526 L-arginine biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004042 L-glutamate N-acetyltransferase activity Molecular Function

GO:0004358 L-glutamate N-acetyltransferase activity, acting on acetyl-L-ornithine as donor Molecular Function

KEGG gene cross-reference

ath:AT2G22910

ath:AT4G37670

avn:Avin_04920

pmy:Pmen_0354

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.529

Rank 1 · TkA05G392220 · TK1151

Cytoplasm0.411

Rank 2 · TkA05G392220 · TK1151

Cell membrane0.063

Rank 3 · TkA05G392220 · TK1151

Mitochondrion0.041

Rank 4 · TkA05G392220 · TK1151

Endoplasmic reticulum0.037

Rank 5 · TkA05G392220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00696AA_kinase24-106 aa

PF08960STIV_B116-like41-77 aa

PF08960STIV_B116-like98-139 aa

PF08445FR47179-212 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G392220	`PF00696`	AA_kinase	24	106	3.9e-07	30.8
TkA05G392220	`PF08960`	STIV_B116-like	41	77	0.046	14.4
TkA05G392220	`PF08960`	STIV_B116-like	98	139	0.046	14.4
TkA05G392220	`PF08445`	FR47	179	212	0.27	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84JF4`	Arabidopsis thaliana	sp\|Q84JF4\|NAGS1_ARATH Probable amino-acid acetyltransferase NAGS1, chloroplastic	48.000%	Swiss-Prot	Medium
`B5X4Z4`	Arabidopsis thaliana	sp\|B5X4Z4\|NAGS2_ARATH Probable amino-acid acetyltransferase NAGS2, chloroplastic	47.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card