LXL04_013628 | RubberDandelionOmics

Gene overview

LXL04_013628

Reference: OH-1004 Chr: Chr03 Coordinates: 33030614-33033080 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1893 bp · LXL04_013628|LXL04_013628|OH1004|cDNA

ATGGCTGTTTCATCTTCCAGTTCTTGCATCTCCCTCCAAAGATTGCGCCGTCAAACGGCTACTTCGGACCTTTTTACGCCGCCGGCAAGTGTTTCCCGATGCTTCATGACCGGGTCGGTAAAGATGCCGGCCTTCAATTCCGCTTCAAGGTTGAAGAATAAGAAGGTTTCCTTCAGCACGTGTAATGTTTTGGGCGAATTTGAGAGTGAAGGCGCCGGCGAAGCGAGCATTAATGCTATGAAGGACGAGGTGTTTGTGAC...

CDS

Download CDS FASTA

1893 bp · LXL04_013628|LXL04_013628|OH1004|CDS

ATGGCTGTTTCATCTTCCAGTTCTTGCATCTCCCTCCAAAGATTGCGCCGTCAAACGGCTACTTCGGACCTTTTTACGCCGCCGGCAAGTGTTTCCCGATGCTTCATGACCGGGTCGGTAAAGATGCCGGCCTTCAATTCCGCTTCAAGGTTGAAGAATAAGAAGGTTTCCTTCAGCACGTGTAATGTTTTGGGCGAATTTGAGAGTGAAGGCGCCGGCGAAGCGAGCATTAATGCTATGAAGGACGAGGTGTTTGTGAC...

Protein

Download Protein FASTA

630 aa · LXL04_013628|LXL04_013628|OH1004|PROTEIN

MAVSSSSSCISLQRLRRQTATSDLFTPPASVSRCFMTGSVKMPAFNSASRLKNKKVSFSTCNVLGEFESEGAGEASINAMKDEVFVTFFREAWPYFTAHRGSTFVVLLSSEVLDSSILDPILKASLYLSFNHLVAVDISLLHGLGIKFVLVPGTHVQIDQRLAEKGREPKYVGRYRITDADALQAAMDSAGRIRFMIEAKLSPGPSLCSIRRHGENRRWHDRVRVLSGNFLAAKVNLIFKLIFPSNDHRCKLIHYNTLQQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013628`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_013628

Location Chr03:33030614-33033080 (-)

Description Similar to NAGS2: Probable amino-acid acetyltransferase NAGS2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g37670`	N-acetylglutamate synthase involved in arginine biosynthesis.	No verified direct reference in this release
`At2g22910`	N-acetylglutamate synthase involved in arginine biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013628 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006526 L-arginine biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004042 L-glutamate N-acetyltransferase activity Molecular Function

GO:0004358 L-glutamate N-acetyltransferase activity, acting on acetyl-L-ornithine as donor Molecular Function

KEGG gene cross-reference

ath:AT2G22910

ath:AT4G37670

avn:Avin_04920

pmy:Pmen_0354

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.892

Rank 1 · LXL04_013628 · OH-1004

Mitochondrion0.096

Rank 2 · LXL04_013628 · OH-1004

Nucleus0.054

Rank 3 · LXL04_013628 · OH-1004

Cytoplasm0.039

Rank 4 · LXL04_013628 · OH-1004

Cell membrane0.021

Rank 5 · LXL04_013628 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00696.34AA_kinase134-353 aa

PF00583.32Acetyltransf_1505-576 aa

PF13508.14Acetyltransf_7510-588 aa

PF23209.2IDM1_C512-597 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013628	`PF00696.34`	AA_kinase	134	353	2.2e-08	34.9
LXL04_013628	`PF00583.32`	Acetyltransf_1	505	576	1.7e-13	51.6
LXL04_013628	`PF13508.14`	Acetyltransf_7	510	588	6.7e-12	46.3
LXL04_013628	`PF23209.2`	IDM1_C	512	597	7.7e-06	26.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B5X4Z4`	Arabidopsis thaliana	Probable amino-acid acetyltransferase NAGS2, chloroplastic	63.411%	Swiss-Prot	strong database homology
`Q84JF4`	Arabidopsis thaliana	Probable amino-acid acetyltransferase NAGS1, chloroplastic	62.582%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card