TkA05G386180 | RubberDandelionOmics

Gene overview

TkA05G386180

Reference: TK1151 Chr: Chr05 Coordinates: 95956325-95958734 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1101 bp · TkA05G386180|TK1151|cDNA

CTAAAAGTACCATTTGGTTGCATTTAGGCTCTTAAACTGGCTGCTATTTAAGCCCTAAAAATAATCGGCTAAATTGGTGTTTTACGGGATTAAAGTCGTTTGACCACGCACTAGCACCCATCACTTTCTTTGTTCTAGCGGGTAGATGGATTCGGCTGGCGATTACCATTATTAAAACCTACTTCTGCATGCAATCGACACCAGCGGAATCACATTCCACTCTCTCATCGCACCCACAACCAGCTTTCTATCTGTAATTA...

CDS

Download CDS FASTA

687 bp · TkA05G386180|TK1151|CDS

ATGAGTCTATCAGTTGTTCAAGGGTTTAGCAAGTCTCTTGCGATGACTGTGCTCTCTGAAATTGGCGACAAGACATTTTTCGCAGCTGCGATTTTGGCGATGCGTCATCCCAGGAGATATGTTCTGGCAGGCTGCCTTTCAGCTTTGATTGTCATGACTATTCTCTCTGCTGCTGTTGGCTGGGCTGCTCCTAACCTGATCTCGCGAACATTGACCAAGCATATCGCGACTATTTTGTTTTTAGGGTTTGGAGTTTGGTC...

Protein

Download Protein FASTA

228 aa · TkA05G386180|TK1151|PROTEIN

MSLSVVQGFSKSLAMTVLSEIGDKTFFAAAILAMRHPRRYVLAGCLSALIVMTILSAAVGWAAPNLISRTLTKHIATILFLGFGVWSLWDAFHEGESEELAEVEAELDADLQANGKTKSNGKADDDDKKKKRPLFSQFFSPIFLKAFSITFFGEWGDKSQIATIGLAAAENPLGVVLGGILGQALCQTAAVFGGKSLAKQISEKFIALSGGVLFIVFGIQSYFSTVDS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G386180`
TK1151 ID	TkA05G386180
OH-1004 ID	LXL04_021389
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 94.215 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G386180

Location Chr05:95956325-95958734 (+)

Description Similar to At1g25520: GDT1-like protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g68650`	GDT1-like protein 5.	No verified direct reference in this release
`At1g25520`	GDT1-like protein 4.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0433100`	GDT1-like protein 5.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021389 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006816 calcium ion transport Biological Process

GO:0006828 manganese ion transport Biological Process

GO:0032468 Golgi calcium ion homeostasis Biological Process

GO:0032472 Golgi calcium ion transport Biological Process

GO:0070588 calcium ion transmembrane transport Biological Process

GO:0071421 manganese ion transmembrane transport Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0035618 root hair Cellular Component

GO:1990676 Golgi trans cisterna membrane Cellular Component

KEGG gene cross-reference

ath:AT1G25520

ath:AT1G68650

ath:AT5G36290

dosa:Os08g0433100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.372

Rank 1 · TkA05G386180 · TK1151

Lysosome / Vacuole0.245

Rank 2 · TkA05G386180 · TK1151

Endoplasmic reticulum0.207

Rank 3 · TkA05G386180 · TK1151

Cytoplasm0.157

Rank 4 · TkA05G386180 · TK1151

Cell membrane0.095

Rank 5 · TkA05G386180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01169GDT19-93 aa

PF19455DUF599326-54 aa

PF06298PsbY49-67 aa

PF27507DjlA_TM54-62 aa

PF01169GDT1143-224 aa

PF27507DjlA_TM162-184 aa

PF06298PsbY180-191 aa

PF19455DUF5993205-218 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G386180	`PF01169`	GDT1	9	93	2.9e-49	165.9
TkA05G386180	`PF19455`	DUF5993	26	54	0.17	12.7
TkA05G386180	`PF06298`	PsbY	49	67	0.22	12.1
TkA05G386180	`PF27507`	DjlA_TM	54	62	0.33	11.9
TkA05G386180	`PF01169`	GDT1	143	224	2.9e-49	165.9
TkA05G386180	`PF27507`	DjlA_TM	162	184	0.33	11.9
TkA05G386180	`PF06298`	PsbY	180	191	0.22	12.1
TkA05G386180	`PF19455`	DUF5993	205	218	0.17	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SX28`	Arabidopsis thaliana	sp\|Q9SX28\|GDT15_ARATH GDT1-like protein 5	74.800%	Swiss-Prot	High
`Q9C6M1`	Arabidopsis thaliana	sp\|Q9C6M1\|GDT14_ARATH GDT1-like protein 4	69.300%	Swiss-Prot	High
`B9G125`	Oryza sativa subsp. japonica	sp\|B9G125\|GDT15_ORYSJ GDT1-like protein 5	67.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card