TkA05G385680 | RubberDandelionOmics

Gene overview

TkA05G385680

Reference: TK1151 Chr: Chr05 Coordinates: 95834416-95836023 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1143 bp · TkA05G385680|TK1151|cDNA

CTCACATATTCTGATTTTCTGAAGCCGGCGCCAAAAGTAGTCATCGGCCACCTTCAAATACACCCTCCCACTTTCCTTCGAATTCATCAAGCGTAGACTTTTCTGGCAAAACTGCAAGTTCATCAAATTCTCTAAAGGAAATCCATGGATATCTTCTCGTACTTCACCTCAGAAATCAATACAGAGAAGATGGATTTTGATGACGACGATTTCGAAGATGCTGAAACAGGAACCGCTCTTTCTTCGATTGCGGATGCATT...

CDS

Download CDS FASTA

699 bp · TkA05G385680|TK1151|CDS

ATGGATATCTTCTCGTACTTCACCTCAGAAATCAATACAGAGAAGATGGATTTTGATGACGACGATTTCGAAGATGCTGAAACAGGAACCGCTCTTTCTTCGATTGCGGATGCATTTGAGGAATTATCCGATTTGATCAAAAAGGATAAGAGTAATGGAGCTTCATTTGAGCTGCGGTTGAAGCCTTTTTGCGATGCCTGTTCTCTAGTCTCTGTACTATTTGGTTCCCTTGGCATCGCTTTCAAATTTGCCGAGATGGA...

Protein

Download Protein FASTA

232 aa · TkA05G385680|TK1151|PROTEIN

MDIFSYFTSEINTEKMDFDDDDFEDAETGTALSSIADAFEELSDLIKKDKSNGASFELRLKPFCDACSLVSVLFGSLGIAFKFAEMEYTSKVRDLSDAASLYGTLSKVVDYDVKSDTVQSAESLTRKLRRVRQGLDLIRELFQNFLSTDEYSLKEAASTAYKQVCAPYHTWAVRTAVSAGMCALPTRDQLLLNLNESDESAESEMRRYIKASLPVINYIDNLYTSRGITLDW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G385680`
TK1151 ID	TkA05G385680
OH-1004 ID	LXL04_021383
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G385680

Location Chr05:95834416-95836023 (+)

Description Similar to At4g39670: ACD11 homolog protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g39670`	ACD11 homolog protein.	No verified direct reference in this release
`At2g34690`	Exhibits selective intermembrane transfer of ceramide-1-phosphate (C1P) and phytoceramide-1-phosphate.	Knockout of Arabidopsis accelerated-cell-death11 encoding a sphingosine transfer protein causes activation of programmed cell death and defense.2002 · DOI: 10.1101/gad.218202 Human GLTP and mutant forms of ACD11 suppress cell death in the Arabidopsis acd11 mutant.2008 · DOI: 10.1111/j.1742-4658.2008.06584.x Identification of proteins interacting with Arabidopsis ACD11.2009 · DOI: 10.1016/j.jplph.2008.08.003 Arabidopsis accelerated cell death 11, ACD11, is a ceramide-1-phosphate transfer protein and intermediary regulator of phytoceramide levels.2014 · DOI: 10.1016/j.celrep.2013.12.023 Phosphatidylserine Stimulates Ceramide 1-Phosphate (C1P) Intermembrane Transfer by C1P Transfer Proteins.2017 · DOI: 10.1074/jbc.m116.760256

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021383 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009751 response to salicylic acid Biological Process

GO:0010507 negative regulation of autophagy Biological Process

GO:0015031 protein transport Biological Process

GO:0032691 negative regulation of interleukin-1 beta production Biological Process

GO:0035621 ER to Golgi ceramide transport Biological Process

GO:0035627 ceramide transport Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0120009 intermembrane lipid transfer Biological Process

GO:1902389 ceramide 1-phosphate transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005640 nuclear outer membrane Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT2G34690

ath:AT4G39670

dre:492502

dre:791641

hsa:80772

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.646

Rank 1 · TkA05G385680 · TK1151

Nucleus0.274

Rank 2 · TkA05G385680 · TK1151

Cell membrane0.127

Rank 3 · TkA05G385680 · TK1151

Golgi apparatus0.114

Rank 4 · TkA05G385680 · TK1151

Endoplasmic reticulum0.093

Rank 5 · TkA05G385680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21069Csx124-67 aa

PF10279Latarcin17-46 aa

PF17107SesA27-68 aa

PF08718GLTP36-53 aa

PF08718GLTP59-195 aa

PF17107SesA116-164 aa

PF17107SesA196-211 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G385680	`PF21069`	Csx12	4	67	0.11	11.9
TkA05G385680	`PF10279`	Latarcin	17	46	0.061	14.3
TkA05G385680	`PF17107`	SesA	27	68	0.029	15.2
TkA05G385680	`PF08718`	GLTP	36	53	2.6e-37	129.0
TkA05G385680	`PF08718`	GLTP	59	195	2.6e-37	129.0
TkA05G385680	`PF17107`	SesA	116	164	0.029	15.2
TkA05G385680	`PF17107`	SesA	196	211	0.029	15.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L7U7`	Arabidopsis thaliana	sp\|Q8L7U7\|ACDH_ARATH ACD11 homolog protein	58.400%	Swiss-Prot	High
`O64587`	Arabidopsis thaliana	sp\|O64587\|ACD11_ARATH Accelerated cell death 11	45.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card