TkA05G384530 | RubberDandelionOmics

Gene overview

TkA05G384530

Reference: TK1151 Chr: Chr05 Coordinates: 95519376-95519747 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

372 bp · TkA05G384530|TK1151|cDNA

ATGGGAGCGCACGTTAGCAAGAGATCTACTGCAGCTACCTCTTACGACTCCCCCGCCATCCCTTTGAAAGACGCACAACAAATCATTACAGAGCTTAATGCATATGAAGCAGCTTGTAGATCTGATACCGATTTGCAATCGTTTGACGCCATGCTACATGCTCGCGCAAACAACGTGATCAATACTTTGGCATCGGGAGTTGAAGTCCGTGCTTTATCTTTCGATACTTTAAAAGAACTCACTGAGTGTCTATTAGAAAT...

CDS

Download CDS FASTA

372 bp · TkA05G384530|TK1151|CDS

ATGGGAGCGCACGTTAGCAAGAGATCTACTGCAGCTACCTCTTACGACTCCCCCGCCATCCCTTTGAAAGACGCACAACAAATCATTACAGAGCTTAATGCATATGAAGCAGCTTGTAGATCTGATACCGATTTGCAATCGTTTGACGCCATGCTACATGCTCGCGCAAACAACGTGATCAATACTTTGGCATCGGGAGTTGAAGTCCGTGCTTTATCTTTCGATACTTTAAAAGAACTCACTGAGTGTCTATTAGAAAT...

Protein

Download Protein FASTA

123 aa · TkA05G384530|TK1151|PROTEIN

MGAHVSKRSTAATSYDSPAIPLKDAQQIITELNAYEAACRSDTDLQSFDAMLHARANNVINTLASGVEVRALSFDTLKELTECLLEMNQEVVKVILRCKKRYLEESGFSQPGSFSNSTSDSKI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G384530`
TK1151 ID	TkA05G384530
OH-1004 ID	LXL04_013476
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	62.000
Protein coverage (%)	TK1151 57.724 / OH-1004 20.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G384530

Location Chr05:95519376-95519747 (+)

Description Similar to At4g34320: UPF0496 protein At4g34320

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34320`	UPF0496 protein At4g34320.	No verified direct reference in this release
`At2g18630`	UPF0496 protein At2g18630.	No verified direct reference in this release
`At4g34330`	UPF0496 protein At4g34330.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XDK8`	UPF0496 protein 1.	No verified direct reference in this release
`Os03g0199100`	UPF0496 protein 1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_013476 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT2G18630

ath:AT4G34320

ath:AT5G66675

dosa:Os03g0199100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.538

Rank 1 · TkA05G384530 · TK1151

Nucleus0.413

Rank 2 · TkA05G384530 · TK1151

Cell membrane0.085

Rank 3 · TkA05G384530 · TK1151

Mitochondrion0.079

Rank 4 · TkA05G384530 · TK1151

Golgi apparatus0.052

Rank 5 · TkA05G384530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24829Phage_connect_237-102 aa

PF03542Tuberin44-95 aa

PF05055DUF67745-105 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G384530	`PF24829`	Phage_connect_2	37	102	0.024	15.6
TkA05G384530	`PF03542`	Tuberin	44	95	0.18	11.7
TkA05G384530	`PF05055`	DUF677	45	105	1.8e-18	67.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SYZ7`	Arabidopsis thaliana	sp\|Q9SYZ7\|U496A_ARATH UPF0496 protein At4g34320	74.600%	Swiss-Prot	Medium
`Q56XQ0`	Arabidopsis thaliana	sp\|Q56XQ0\|U496I_ARATH UPF0496 protein At2g18630	50.500%	Swiss-Prot	High
`Q9SYZ8`	Arabidopsis thaliana	sp\|Q9SYZ8\|U496B_ARATH UPF0496 protein At4g34330	59.000%	Swiss-Prot	Medium
`A2XDK8`	Oryza sativa subsp. indica	sp\|A2XDK8\|U496A_ORYSI UPF0496 protein 1	62.900%	Swiss-Prot	Medium
`Q10QE9`	Oryza sativa subsp. japonica	sp\|Q10QE9\|U496A_ORYSJ UPF0496 protein 1	62.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card