TkA05G373700 | RubberDandelionOmics

Gene overview

TkA05G373700

Reference: TK1151 Chr: Chr05 Coordinates: 92798654-92799928 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1275 bp · TkA05G373700|TK1151|cDNA

ATGATGGAGCCCTTAACAGAAGTTAGGGACGGTTACCTAATTTCTCTTAACCTAGGCTCACCTCCACAAATCATTCAAGTCTATATGGATACCGGAAGTGATCTCACTTGGGTACCTTGCGGAAATCTTTCCTTTAACTGCATTAACTGTGACGACTATCCAAATAACACACCCATTTCCAAGTTCTCACCTTTTCAATCATCTTCTTGTGTTCGAGACTCTTGCGTCAGTAACCTGTGTATCAACGTCCATAGCTCCGA...

CDS

Download CDS FASTA

1275 bp · TkA05G373700|TK1151|CDS

ATGATGGAGCCCTTAACAGAAGTTAGGGACGGTTACCTAATTTCTCTTAACCTAGGCTCACCTCCACAAATCATTCAAGTCTATATGGATACCGGAAGTGATCTCACTTGGGTACCTTGCGGAAATCTTTCCTTTAACTGCATTAACTGTGACGACTATCCAAATAACACACCCATTTCCAAGTTCTCACCTTTTCAATCATCTTCTTGTGTTCGAGACTCTTGCGTCAGTAACCTGTGTATCAACGTCCATAGCTCCGA...

Protein

Download Protein FASTA

424 aa · TkA05G373700|TK1151|PROTEIN

MMEPLTEVRDGYLISLNLGSPPQIIQVYMDTGSDLTWVPCGNLSFNCINCDDYPNNTPISKFSPFQSSSCVRDSCVSNLCINVHSSDNPYDPCNIAGCSLTTLIKGTCSRPCPSFVYMYGEGVVSGTLTRDTLRVHGSSVTREVTNFGFGCVGSTYREPIGIAGFGKGSLSLPSQLGFQEKGFSHCFLAFKFANNPNVSSPLVLGDLAISSNDQNQLQFTPMLKNPMYPNYYYIGLEGLSLGIGSGSLIQVPTTLSEFDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G373700`
TK1151 ID	TkA05G373700
OH-1004 ID	LXL04_021266
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 85.312 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G373700

Location Chr05:92798654-92799928 (-)

Description Similar to At4g16563: Probable aspartyl protease At4g16563

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g16563`	Probable aspartyl protease At4g16563.	No verified direct reference in this release
`At1g01300`	Aspartyl protease.	No verified direct reference in this release
`At3g20015`	Aspartic protease that may be involved in drought avoidance through abscisic acid signaling.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021266 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0043067 regulation of programmed cell death Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0048046 apoplast Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0000166 nucleotide binding Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G09750

ath:AT4G16563

dosa:Os03g0186900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.327

Rank 1 · TkA05G373700 · TK1151

Cell membrane0.222

Rank 2 · TkA05G373700 · TK1151

Endoplasmic reticulum0.132

Rank 3 · TkA05G373700 · TK1151

Lysosome / Vacuole0.124

Rank 4 · TkA05G373700 · TK1151

Cytoplasm0.118

Rank 5 · TkA05G373700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14543TAXi_N12-206 aa

PF00026Asp12-71 aa

PF00026Asp116-142 aa

PF00026Asp178-211 aa

PF14541TAXi_C232-408 aa

PF00026Asp261-408 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G373700	`PF14543`	TAXi_N	12	206	1.8e-27	97.4
TkA05G373700	`PF00026`	Asp	12	71	1.2e-13	51.9
TkA05G373700	`PF00026`	Asp	116	142	1.2e-13	51.9
TkA05G373700	`PF00026`	Asp	178	211	1.2e-13	51.9
TkA05G373700	`PF14541`	TAXi_C	232	408	2e-27	96.7
TkA05G373700	`PF00026`	Asp	261	408	1.2e-13	51.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q940R4`	Arabidopsis thaliana	sp\|Q940R4\|ASP63_ARATH Probable aspartyl protease At4g16563	36.800%	Swiss-Prot	Medium
`Q9LNJ3`	Arabidopsis thaliana	sp\|Q9LNJ3\|APF2_ARATH Aspartyl protease family protein 2	28.800%	Swiss-Prot	Low
`Q9LHE3`	Arabidopsis thaliana	sp\|Q9LHE3\|ASPG2_ARATH Protein ASPARTIC PROTEASE IN GUARD CELL 2	28.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card