LXL04_021266 | RubberDandelionOmics

Gene overview

LXL04_021266

Reference: OH-1004 Chr: Chr04 Coordinates: 126129029-126130522 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1494 bp · LXL04_021266|LXL04_021266|OH1004|cDNA

ATGACTCCTCTCTTCACGTCTTATATTACCTTCAACTTGCTCATCTTTGTCTCTCTTCTCTCTATTACCAACCATTCCCACGCAAGACAACACCCAAAAACTTCAGATTCTCTAGTCCTAGGTTTAACAAACACCAGGACCACCATCAAACTTCCCAAACAATCATCATCCACCTTAAACCTTAAACTAACTTCGTCCCCGTCGTCACCAACCCTAGACATGATGGAGCCCTTAACAGAAGTTAGGGACGGTTACCTAAT...

CDS

Download CDS FASTA

1494 bp · LXL04_021266|LXL04_021266|OH1004|CDS

ATGACTCCTCTCTTCACGTCTTATATTACCTTCAACTTGCTCATCTTTGTCTCTCTTCTCTCTATTACCAACCATTCCCACGCAAGACAACACCCAAAAACTTCAGATTCTCTAGTCCTAGGTTTAACAAACACCAGGACCACCATCAAACTTCCCAAACAATCATCATCCACCTTAAACCTTAAACTAACTTCGTCCCCGTCGTCACCAACCCTAGACATGATGGAGCCCTTAACAGAAGTTAGGGACGGTTACCTAAT...

Protein

Download Protein FASTA

497 aa · LXL04_021266|LXL04_021266|OH1004|PROTEIN

MTPLFTSYITFNLLIFVSLLSITNHSHARQHPKTSDSLVLGLTNTRTTIKLPKQSSSTLNLKLTSSPSSPTLDMMEPLTEVRDGYLISLNLGSPPQIIQVYMDTGSDLTWVPCGNLSFNCINCDDYPNNTPMSKFSPFQSSSCVRDSCVSNLCINVHSSDNPYDPCNIAGCSLTTLIKGTCSRPCPSFVYMYGEGVVSGTLTRDTLRVHGSSVTREVTNFGFGCVGSTYREPIGIAGFGKGSLSLPSQLGFQEMGFSHCF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_021266`
TK1151 ID	TkA05G373700
OH-1004 ID	LXL04_021266
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.800
Protein coverage (%)	TK1151 100.000 / OH-1004 85.312 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_021266

Location Chr04:126129029-126130522 (-)

Description Similar to At4g16563: Probable aspartyl protease At4g16563

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g16563`	Probable aspartyl protease At4g16563.	No verified direct reference in this release
`At1g09750`	Aspartyl protease AED3.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0186900`	Anther-specific aspartic protease involved in tapetal programmed cell death (PCD).	EAT1 promotes tapetal cell death by regulating aspartic proteases during male reproductive development in rice.2013 · DOI: 10.1038/ncomms2396

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021266 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0043067 regulation of programmed cell death Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0048046 apoplast Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0000166 nucleotide binding Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G09750

ath:AT4G16563

dosa:Os03g0186900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.303

Rank 1 · LXL04_021266 · OH-1004

Extracellular0.280

Rank 2 · LXL04_021266 · OH-1004

Endoplasmic reticulum0.156

Rank 3 · LXL04_021266 · OH-1004

Cytoplasm0.106

Rank 4 · LXL04_021266 · OH-1004

Lysosome / Vacuole0.091

Rank 5 · LXL04_021266 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14543.12TAXi_N85-279 aa

PF00026.29Asp85-145 aa

PF00026.29Asp189-481 aa

PF14541.12TAXi_C305-481 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_021266	`PF14543.12`	TAXi_N	85	279	3.2e-27	96.5
LXL04_021266	`PF00026.29`	Asp	85	145	1.1e-13	52.1
LXL04_021266	`PF00026.29`	Asp	189	481	1.1e-13	52.1
LXL04_021266	`PF14541.12`	TAXi_C	305	481	1.9e-26	93.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q940R4`	Arabidopsis thaliana	Probable aspartyl protease At4g16563	35.011%	Swiss-Prot	moderate database homology
`O04496`	Arabidopsis thaliana	Aspartyl protease AED3	26.521%	Swiss-Prot	weak database homology
`Q6F4N5`	Oryza sativa subsp. japonica	Aspartyl protease 25	27.764%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card