TkA05G371500 | RubberDandelionOmics

Gene overview

TkA05G371500

Reference: TK1151 Chr: Chr05 Coordinates: 92254587-92255104 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

359 bp · TkA05G371500|TK1151|cDNA

AAGTATGACTTTACTGCAAAAGGCGAGACAGTAAAAAATTATACTTTTTACAACTACACATCTGGTTACATTCATCAGTACCATCTTGAAAACCTTGAGTATGACACCAAGTACTATTATGAGATTGGAGAAGGTGATTCTGCTCGATCATTTTGGTTTCAAACACCTCCAAAGATCGATCCAAATGCTTCTTACAAATTCGGAAGCATTGGCGACCTGGGTCAAACTTACAACTCTCTATCCACTCTTGAACATTACAT...

CDS

Download CDS FASTA

345 bp · TkA05G371500|TK1151|CDS

AAGTATGACTTTACTGCAAAAGGCGAGACAGTAAAAAATTATACTTTTTACAACTACACATCTGGTTACATTCATCAGTACCATCTTGAAAACCTTGAGTATGACACCAAGTACTATTATGAGATTGGAGAAGGTGATTCTGCTCGATCATTTTGGTTTCAAACACCTCCAAAGATCGATCCAAATGCTTCTTACAAATTCGGAAGCATTGGCGACCTGGGTCAAACTTACAACTCTCTATCCACTCTTGAACATTACAT...

Protein

Download Protein FASTA

114 aa · TkA05G371500|TK1151|PROTEIN

KYDFTAKGETVKNYTFYNYTSGYIHQYHLENLEYDTKYYYEIGEGDSARSFWFQTPPKIDPNASYKFGSIGDLGQTYNSLSTLEHYIESGAQTVLHVGDISYADRYKYHDMGVR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G371500`
TK1151 ID	TkA05G371500
OH-1004 ID	LXL04_021248
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.100
Protein coverage (%)	TK1151 97.368 / OH-1004 28.316 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G371500

Location Chr05:92254587-92255104 (-)

Description Similar to PAP26: Bifunctional purple acid phosphatase 26

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g34850`	Metallo-phosphoesterase involved in phosphate metabolism.	Biochemical and molecular characterization of AtPAP26, a vacuolar purple acid phosphatase up-regulated in phosphate-deprived Arabidopsis suspension cells and seedlings.2006 · DOI: 10.1104/pp.106.087171
`At2g27190`	Fe(3+)-Zn(2+) purple acid phosphatase 12.	No verified direct reference in this release
`At2g16430`	Purple acid phosphatase 10.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021248 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0042744 hydrogen peroxide catabolic process Biological Process

GO:0051174 regulation of phosphorus metabolic process Biological Process

GO:0055062 phosphate ion homeostasis Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005775 vacuolar lumen Cellular Component

GO:0009536 plastid Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0003993 acid phosphatase activity Molecular Function

GO:0004721 phosphoprotein phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT5G34850

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.594

Rank 1 · TkA05G371500 · TK1151

Lysosome / Vacuole0.229

Rank 2 · TkA05G371500 · TK1151

Cytoplasm0.119

Rank 3 · TkA05G371500 · TK1151

Endoplasmic reticulum0.060

Rank 4 · TkA05G371500 · TK1151

Cell membrane0.046

Rank 5 · TkA05G371500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16656Pur_ac_phosph_N2-54 aa

PF16656Pur_ac_phosph_N88-108 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G371500	`PF16656`	Pur_ac_phosph_N	2	54	3e-09	38.1
TkA05G371500	`PF16656`	Pur_ac_phosph_N	88	108	3e-09	38.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q949Y3`	Arabidopsis thaliana	sp\|Q949Y3\|PPA26_ARATH Bifunctional purple acid phosphatase 26	66.700%	Swiss-Prot	High
`Q38924`	Arabidopsis thaliana	sp\|Q38924\|PPA12_ARATH Fe(3+)-Zn(2+) purple acid phosphatase 12	62.100%	Swiss-Prot	High
`Q9SIV9`	Arabidopsis thaliana	sp\|Q9SIV9\|PPA10_ARATH Purple acid phosphatase 10	58.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card