Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1179 bp · LXL04_021248|LXL04_021248|OH1004|cDNA
ATGTTGCTGATGAGATTGAGCTTCAATGGTATCACAAGCACTTTCATACGTTCAGAATGGCCATCAGTTGACATTCCTCTTGATAATGAAGTATTTGTGAAACCCAAAGGCTATAATGCACCAGAGCAGGTACACATCACTCAAGGAGATTATGATGGAAAAGCCATGATCATAATATGGGTGACACCTGATGAACCAGGGTCAAACCAAGTCAAATATGGAACATCAGAGAAAAAGTATGACTTTACTGCAAAAGGCGA...
1179 bp · LXL04_021248|LXL04_021248|OH1004|CDS
ATGTTGCTGATGAGATTGAGCTTCAATGGTATCACAAGCACTTTCATACGTTCAGAATGGCCATCAGTTGACATTCCTCTTGATAATGAAGTATTTGTGAAACCCAAAGGCTATAATGCACCAGAGCAGGTACACATCACTCAAGGAGATTATGATGGAAAAGCCATGATCATAATATGGGTGACACCTGATGAACCAGGGTCAAACCAAGTCAAATATGGAACATCAGAGAAAAAGTATGACTTTACTGCAAAAGGCGA...
Protein
Download Protein FASTA392 aa · LXL04_021248|LXL04_021248|OH1004|PROTEIN
MLLMRLSFNGITSTFIRSEWPSVDIPLDNEVFVKPKGYNAPEQVHITQGDYDGKAMIIIWVTPDEPGSNQVKYGTSEKKYDFTAKGETVKNYTFYNYTSGYIHQYHLENLEYDTKYYYEIGEGDSARSFWFQTPPKIDPNASYKFGSIGDLGQTYNSLSTLEHYVESGAQTVLHVGDISYADRYKYHDMVKYTPQWEWLQDEFKKVDRKQTPWLINKVDVVFAGHVHAYERSYRISNIHYNITSGVHKDHKNPFLMSGCK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_021248 |
|---|---|
| TK1151 ID | TkA05G371500 |
| OH-1004 ID | LXL04_021248 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 99.100 |
| Protein coverage (%) | TK1151 97.368 / OH-1004 28.316Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_021248 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:125595927-125598880 (-) | |||||||||
| Description | Similar to PAP26: Bifunctional purple acid phosphatase 26 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0042744 hydrogen peroxide catabolic process Biological Process GO:0051174 regulation of phosphorus metabolic process Biological Process GO:0055062 phosphate ion homeostasis Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005576 extracellular region Cellular Component GO:0005773 vacuole Cellular Component GO:0005775 vacuolar lumen Cellular Component GO:0009536 plastid Cellular Component GO:0099503 secretory vesicle Cellular Component GO:0003993 acid phosphatase activity Molecular Function GO:0004721 phosphoprotein phosphatase activity Molecular Function GO:0046872 metal ion binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT5G34850 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF16656.12Pur_ac_phosph_N41-132 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_021248 | PF16656.12 | Pur_ac_phosph_N | 41 | 132 | 1.9e-22 | 80.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.