TkA05G369200 | RubberDandelionOmics

Gene overview

TkA05G369200

Reference: TK1151 Chr: Chr05 Coordinates: 91680622-91681433 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

639 bp · TkA05G369200|TK1151|cDNA

ATGGTTACAGGACTAGGGCCTACTAGCCTCATCGGCCGATGTCTGCCGTCTCGCGATTCTTGCGTTTATGGACCGAAGGAAAATAACTCCAATCCTTCTTCAGGGCAACATGCTATATTATATGATATATCTTGGGAGTTGAAGGTCGCAGTCCCTTTCCCTCAGGCGAGTTCCTCACTTAACTTAAAAGAGGAAGGAGTCTTTGCGAATTCAGTAGCTATGCTATATGCGTTGAATCTTGAGAATGAGAATGTAGGGAT...

CDS

Download CDS FASTA

639 bp · TkA05G369200|TK1151|CDS

ATGGTTACAGGACTAGGGCCTACTAGCCTCATCGGCCGATGTCTGCCGTCTCGCGATTCTTGCGTTTATGGACCGAAGGAAAATAACTCCAATCCTTCTTCAGGGCAACATGCTATATTATATGATATATCTTGGGAGTTGAAGGTCGCAGTCCCTTTCCCTCAGGCGAGTTCCTCACTTAACTTAAAAGAGGAAGGAGTCTTTGCGAATTCAGTAGCTATGCTATATGCGTTGAATCTTGAGAATGAGAATGTAGGGAT...

Protein

Download Protein FASTA

212 aa · TkA05G369200|TK1151|PROTEIN

MVTGLGPTSLIGRCLPSRDSCVYGPKENNSNPSSGQHAILYDISWELKVAVPFPQASSSLNLKEEGVFANSVAMLYALNLENENVGIVVFGSDTAIKEGDLVKRTGSIVDVPAGKAMLGRVVDALGVPIDGRGALSDHERRRVEVKAPGIIERKSVHEPMQTGLKAVDSLVPIGRGQRELIIRDRQTGKTAIAIDTILNQKHDSATFIKIND

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G369200`
TK1151 ID	TkA05G369200
OH-1004 ID	LXL04_011315
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	31.100
Protein coverage (%)	TK1151 62.736 / OH-1004 24.281 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA05G369200`
Location	Chr05:91680622-91681433 (-)
Description	Similar to ATPB: ATP synthase subunit beta, mitochondrial
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_011315` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0015986 proton motive force-driven ATP synthesis Biological Process GO:0042776 proton motive force-driven mitochondrial ATP synthesis Biological Process GO:0005743 mitochondrial inner membrane Cellular Component GO:0045259 proton-transporting ATP synthase complex Cellular Component GO:0005524 ATP binding Molecular Function GO:0016887 ATP hydrolysis activity Molecular Function GO:0046933 proton-transporting ATP synthase activity, rotational mechanism Molecular Function
KEGG gene cross-reference	dosa:Os05g0553000 zma:542267 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.446

Rank 1 · TkA05G369200 · TK1151

Cytoplasm0.206

Rank 2 · TkA05G369200 · TK1151

Mitochondrion0.142

Rank 3 · TkA05G369200 · TK1151

Nucleus0.123

Rank 4 · TkA05G369200 · TK1151

Peroxisome0.058

Rank 5 · TkA05G369200 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02874ATP-synt_ab_N77-106 aa

PF02874ATP-synt_ab_N143-158 aa

PF00006ATP-synt_ab163-203 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G369200	`PF02874`	ATP-synt_ab_N	77	106	1.2e-07	32.8
TkA05G369200	`PF02874`	ATP-synt_ab_N	143	158	1.2e-07	32.8
TkA05G369200	`PF00006`	ATP-synt_ab	163	203	2.8e-09	37.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card