TkA05G361950 | RubberDandelionOmics

Gene overview

TkA05G361950

Reference: TK1151 Chr: Chr05 Coordinates: 89857012-89857658 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

465 bp · TkA05G361950|TK1151|cDNA

ATGCTTTTCTTATCGCTTTCTACGGCAAACTCCTTAATCTATATTGAATGCTCTCAACCCGACTTCACCATGATGACACCCTATGAGTCAAATATCAACTACCTATTCAATACCTTACTTGACTCCGCCTCTATCTCCAACTTCAACAAATCTATAATATGCTACCCTGAATCCTCACAAAGTGACGCTGTTTATGGTCTATTCCAATGCCGCAACGACCTTAGCTCTTCCAACTGCAAAGATTGCGTTGCCAACTCTTT...

CDS

Download CDS FASTA

465 bp · TkA05G361950|TK1151|CDS

ATGCTTTTCTTATCGCTTTCTACGGCAAACTCCTTAATCTATATTGAATGCTCTCAACCCGACTTCACCATGATGACACCCTATGAGTCAAATATCAACTACCTATTCAATACCTTACTTGACTCCGCCTCTATCTCCAACTTCAACAAATCTATAATATGCTACCCTGAATCCTCACAAAGTGACGCTGTTTATGGTCTATTCCAATGCCGCAACGACCTTAGCTCTTCCAACTGCAAAGATTGCGTTGCCAACTCTTT...

Protein

Download Protein FASTA

154 aa · TkA05G361950|TK1151|PROTEIN

MLFLSLSTANSLIYIECSQPDFTMMTPYESNINYLFNTLLDSASISNFNKSIICYPESSQSDAVYGLFQCRNDLSSSNCKDCVANSLSQLKTTCPTSTSGKIHVQGVAQCVQDLTINECEDCLLEAYRRLRSECETSSSADMFGKLLYTICGSR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G361950`
TK1151 ID	TkA05G361950
OH-1004 ID	LXL04_021182
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 66.234 / OH-1004 32.381 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G361950

Location Chr05:89857012-89857658 (+)

Description Similar to PDLP6: Plasmodesmata-located protein 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g37660`	Modulates cell-to-cell trafficking.	No verified direct reference in this release
`At2g01660`	Modulates cell-to-cell trafficking.	No verified direct reference in this release
`At3g60720`	Modulates cell-to-cell trafficking.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021182 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009615 response to virus Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0051707 response to other organism Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0001872 (1->3)-beta-D-glucan binding Molecular Function

KEGG gene cross-reference

ath:AT1G70690

ath:AT2G01660

ath:AT3G22060

ath:AT3G60720

ath:AT5G37660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.363

Rank 1 · TkA05G361950 · TK1151

Cell membrane0.308

Rank 2 · TkA05G361950 · TK1151

Endoplasmic reticulum0.113

Rank 3 · TkA05G361950 · TK1151

Cytoplasm0.095

Rank 4 · TkA05G361950 · TK1151

Nucleus0.042

Rank 5 · TkA05G361950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01657Stress-antifung17-102 aa

PF31055DUF879454-87 aa

PF26129Vwde69-98 aa

PF23091TNFR_ELAPOR1_6th75-101 aa

PF13923zf-C3HC4_278-96 aa

PF26129Vwde79-138 aa

PF31055DUF879491-128 aa

PF01657Stress-antifung101-141 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G361950	`PF01657`	Stress-antifung	17	102	5.6e-19	69.4
TkA05G361950	`PF31055`	DUF8794	54	87	2.2	9.2
TkA05G361950	`PF26129`	Vwde	69	98	0.94	9.9
TkA05G361950	`PF23091`	TNFR_ELAPOR1_6th	75	101	3.9	8.2
TkA05G361950	`PF13923`	zf-C3HC4_2	78	96	2.6	8.6
TkA05G361950	`PF26129`	Vwde	79	138	0.94	9.9
TkA05G361950	`PF31055`	DUF8794	91	128	2.2	9.2
TkA05G361950	`PF01657`	Stress-antifung	101	141	5.6e-19	69.4
TkA05G361950	`PF23091`	TNFR_ELAPOR1_6th	118	127	3.9	8.2
TkA05G361950	`PF13923`	zf-C3HC4_2	119	129	2.6	8.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WPN8`	Arabidopsis thaliana	sp\|Q0WPN8\|PDLP7_ARATH Plasmodesmata-located protein 7	40.600%	Swiss-Prot	Medium
`Q9ZU94`	Arabidopsis thaliana	sp\|Q9ZU94\|PDLP6_ARATH Plasmodesmata-located protein 6	38.000%	Swiss-Prot	Medium
`Q6NKQ9`	Arabidopsis thaliana	sp\|Q6NKQ9\|PDLP8_ARATH Plasmodesmata-located protein 8	39.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card