TkA05G337650 | RubberDandelionOmics

Gene overview

TkA05G337650

Reference: TK1151 Chr: Chr05 Coordinates: 83460630-83462605 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1398 bp · TkA05G337650|TK1151|cDNA

TGAGTTTCATTTCAGTCCTGCTTTGAACACCGTACTGCATATACACAGAGCTCGATCAGCTTTTTGGAGGAATTTTTGATAGTTTGAGTTAACGAGGAGGAATCTCTATAATCCTTTAATTCTTTCTGACGAATTGAAACCCTAGAATTTCTGTTGAATGTTAATTCGGCTTGGTTTTTCTGGTTTTTGTTAGGTAAAGTTTGTGGGATATAGGAGTTTGAAATTTTGTGTTATTTAGTCCTTGGCCACCAGATCTTAAT...

CDS

Download CDS FASTA

921 bp · TkA05G337650|TK1151|CDS

ATGCCGTCGCACGCGGATCTAGATCGACAGATAGAGCAGTTGATGGAGTGCAAGCCGTTGACGGAATCGGAGGTAAAAACGCTTTGTGAGCAGGCTAGGGCTATACTCGTGGAGGAATGGAATGTGCAGCCGGTGAAGTGTCCCGTAACGGTGTGCGGTGATATCCATGGTCAATTTTACGATCTTCTCGAGCTCTTTCGGATCGGTGGAAATCCCCCTGATACCAATTATCTCTTCATGGGAGATTATGTTGATCGTGG...

Protein

Download Protein FASTA

306 aa · TkA05G337650|TK1151|PROTEIN

MPSHADLDRQIEQLMECKPLTESEVKTLCEQARAILVEEWNVQPVKCPVTVCGDIHGQFYDLLELFRIGGNPPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRDRLTILRGNHESRQITQVYGFYDECLRKYGNANVWKHFTDLFDYLPLTALIESQIFCLHGGLSPSLDTLDNIRALDRIQEVPHEGPMCDLLWSDPDDRCGWGISPRGAGYTFGQDIASQFNHTNGLSLISRAHQLVMEGFNWCQDKNVVTVFSAP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G337650`
TK1151 ID	TkA05G337650
OH-1004 ID	LXL04_025230
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	96.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G337650

Location Chr05:83460630-83462605 (+)

Description Similar to PP2A2: Serine/threonine-protein phosphatase PP2A-2 catalytic subunit

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g10430`	Dephosphorylates and activates the actin-depolymerizing factor ADF1, which, in turn, regulates actin cytoskeleton remodeling and is involved in the blue light photoreceptor PHOT2-mediated chloroplast avoidance movements.	No verified direct reference in this release
`At1g59830`	Serine/threonine-protein phosphatase PP2A-1 catalytic subunit.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YEB4`	Serine/threonine-protein phosphatase PP2A-1 catalytic subunit.	No verified direct reference in this release
`Os06g0574500`	Serine/threonine-protein phosphatase PP2A-1 catalytic subunit.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025230 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000278 mitotic cell cycle Biological Process

GO:0006470 protein dephosphorylation Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009903 chloroplast avoidance movement Biological Process

GO:0032000 positive regulation of fatty acid beta-oxidation Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G10430

ath:AT1G59830

ath:AT1G69960

dosa:Os06g0574500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.751

Rank 1 · TkA05G337650 · TK1151

Nucleus0.527

Rank 2 · TkA05G337650 · TK1151

Mitochondrion0.060

Rank 3 · TkA05G337650 · TK1151

Cell membrane0.051

Rank 4 · TkA05G337650 · TK1151

Peroxisome0.040

Rank 5 · TkA05G337650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16891STPPase_N19-38 aa

PF00149Metallophos48-241 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G337650	`PF16891`	STPPase_N	19	38	0.007	17.5
TkA05G337650	`PF00149`	Metallophos	48	241	1.7e-46	159.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q07098`	Arabidopsis thaliana	sp\|Q07098\|PP2A2_ARATH Serine/threonine-protein phosphatase PP2A-2 catalytic subunit	93.500%	Swiss-Prot	High
`Q07099`	Arabidopsis thaliana	sp\|Q07099\|PP2A1_ARATH Serine/threonine-protein phosphatase PP2A-1 catalytic subunit	91.800%	Swiss-Prot	High
`A2YEB4`	Oryza sativa subsp. indica	sp\|A2YEB4\|PP2A1_ORYSI Serine/threonine-protein phosphatase PP2A-1 catalytic subunit	92.200%	Swiss-Prot	High
`Q0DBD3`	Oryza sativa subsp. japonica	sp\|Q0DBD3\|PP2A1_ORYSJ Serine/threonine-protein phosphatase PP2A-1 catalytic subunit	92.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card