TkA05G334800 | RubberDandelionOmics

Gene overview

TkA05G334800

Reference: TK1151 Chr: Chr05 Coordinates: 82492803-82495956 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1693 bp · TkA05G334800|TK1151|cDNA

GATAAATTAACGCATTATTTTCTTTAATGTCACCAAATTCTGAAATATTAGATTAAATTTAAACATATATTCACCAAAAAACAGAAAGAAAAACAAGAAACGCGATAATTTCTTCCATTTTTGTCCAACATTCATCAATTCGAAGCTCCCAAGTTGTCTAATTTCACCAACACGCTACTTTCTGGTCTAGTAAGTTCAAAGATTCAATTTTTTTCTTATTACTCCTAATACACCGTTAAGTGTCTCACATATGATTCAAA...

CDS

Download CDS FASTA

1140 bp · TkA05G334800|TK1151|CDS

ATGGCATCTAACCCAGATGAAGAGGTTGTTCTTGCCGAAAACAAAGGGCATGTGAGATTGATCACCTTGAATCAGCCAAAAAAACTAAATATCATTTCATCAAAAGTGGTTTATTTATTGGCACAAAATTTGGAGAAATGGGAAAAAGATGAAGATGCAAAGCTAGTGATTATTAAGGGCGCAGGTCGTGCATTTTCTTCTGGTGGCGATCTAAAAATGTTTTATGATGGAAGGACATCAAAGGATTCATGTCTTGAAGT...

Protein

Download Protein FASTA

379 aa · TkA05G334800|TK1151|PROTEIN

MASNPDEEVVLAENKGHVRLITLNQPKKLNIISSKVVYLLAQNLEKWEKDEDAKLVIIKGAGRAFSSGGDLKMFYDGRTSKDSCLEVVYRFYWLCYHIHTYKKPQVALVHGISMGGGASLMVPIKFSVVTEKTVFATPEASIGFHTDCGFSYILSRLPGHLGEYIALTGARLSGAELVAAKLATHLVPLDKLSMLESRLVSLNSGDEEAVKSAIEEFSLSVQISEESVLSKQSIINECFSKDSVEEIIETFEAESRKEGN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G334800`
TK1151 ID	TkA05G334800
OH-1004 ID	LXL04_020942
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G334800

Location Chr05:82492803-82495956 (+)

Description Similar to At1g06550: 3-hydroxyisobutyryl-CoA hydrolase-like protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g06550`	3-hydroxyisobutyryl-CoA hydrolase-like protein 5.	No verified direct reference in this release
`At5g65940`	Involved in valine catabolism.	Arabidopsis Chy1 null mutants are deficient in benzoic acid-containing glucosinolates in the seeds.2009 · DOI: 10.1111/j.1438-8677.2008.00160.x
`At3g60510`	3-hydroxyisobutyryl-CoA hydrolase-like protein 1, mitochondrial.	No verified direct reference in this release
`At2g30660`	Involved in valine catabolism.	No verified direct reference in this release
`At2g30650`	Involved in valine catabolism.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020942 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006574 L-valine catabolic process Biological Process

GO:0006635 fatty acid beta-oxidation Biological Process

GO:0009409 response to cold Biological Process

GO:0009733 response to auxin Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0009536 plastid Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003860 3-hydroxyisobutyryl-CoA hydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT1G06550

ath:AT2G30650

ath:AT2G30660

ath:AT4G31810

ath:AT5G65940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.621

Rank 1 · TkA05G334800 · TK1151

Peroxisome0.198

Rank 2 · TkA05G334800 · TK1151

Nucleus0.186

Rank 3 · TkA05G334800 · TK1151

Mitochondrion0.120

Rank 4 · TkA05G334800 · TK1151

Cell membrane0.057

Rank 5 · TkA05G334800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00378ECH_115-256 aa

PF16113ECH_218-350 aa

PF19856DUF6331203-254 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G334800	`PF00378`	ECH_1	15	256	8.9e-30	104.6
TkA05G334800	`PF16113`	ECH_2	18	350	1.5e-112	377.1
TkA05G334800	`PF19856`	DUF6331	203	254	0.22	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SHJ8`	Arabidopsis thaliana	sp\|Q9SHJ8\|HIBC8_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 5	70.800%	Swiss-Prot	High
`Q9LKJ1`	Arabidopsis thaliana	sp\|Q9LKJ1\|HIBC1_ARATH 3-hydroxyisobutyryl-CoA hydrolase 1	42.300%	Swiss-Prot	Medium
`Q5XF59`	Arabidopsis thaliana	sp\|Q5XF59\|HIBC4_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, mitochondrial	42.300%	Swiss-Prot	Medium
`Q6NMB0`	Arabidopsis thaliana	sp\|Q6NMB0\|HIBC3_ARATH Probable 3-hydroxyisobutyryl-CoA hydrolase 3	41.400%	Swiss-Prot	Medium
`Q1PEY5`	Arabidopsis thaliana	sp\|Q1PEY5\|HIBC2_ARATH Probable 3-hydroxyisobutyryl-CoA hydrolase 2	42.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card