LXL04_020942 | RubberDandelionOmics

Gene overview

LXL04_020942

Reference: OH-1004 Chr: Chr04 Coordinates: 115911766-115914578 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1140 bp · LXL04_020942|LXL04_020942|OH1004|cDNA

ATGGCAACAAACCCAGATGAAGAGGTTGTTCTTGCCGAAAACAAAGGGAATGTGAGATTGATCACCTTGAATCAGCCAAAAAAACTAAatatcatttcatcaaaagTGGTTTATTTATTGGCACAAAATTTGGAGAAATGGGAAAAAGATGAAGACGCAAAGCTAGTGATCATTAAGGGCGCAGGTCGTGCATTTTCTTCTGGCGGCGATCTAAAAATGTTTTATGATGGAAGGACATCAAAGGATTCATGTCTTGAAGT...

CDS

Download CDS FASTA

1140 bp · LXL04_020942|LXL04_020942|OH1004|CDS

ATGGCAACAAACCCAGATGAAGAGGTTGTTCTTGCCGAAAACAAAGGGAATGTGAGATTGATCACCTTGAATCAGCCAAAAAAACTAAATATCATTTCATCAAAAGTGGTTTATTTATTGGCACAAAATTTGGAGAAATGGGAAAAAGATGAAGACGCAAAGCTAGTGATCATTAAGGGCGCAGGTCGTGCATTTTCTTCTGGCGGCGATCTAAAAATGTTTTATGATGGAAGGACATCAAAGGATTCATGTCTTGAAGT...

Protein

Download Protein FASTA

379 aa · LXL04_020942|LXL04_020942|OH1004|PROTEIN

MATNPDEEVVLAENKGNVRLITLNQPKKLNIISSKVVYLLAQNLEKWEKDEDAKLVIIKGAGRAFSSGGDLKMFYDGRTSKDSCLEVVYRFYWLCYHIHTYKKPQVALVHGISMGGGASLMVPIKFSVVTEKTVFATPEASIGFHTDCGFSYILSRLPGHLGEYIALTGARLSGAELVAAKLATHLVPLDKLSMLESRLVSLNSGDEEAVKSAIEEFSLSVQISEESVLSKQSIINECFSKDSVEEIIETFEAESRKEGN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_020942`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_020942

Location Chr04:115911766-115914578 (-)

Description Similar to At1g06550: 3-hydroxyisobutyryl-CoA hydrolase-like protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g06550`	3-hydroxyisobutyryl-CoA hydrolase-like protein 5.	No verified direct reference in this release
`At5g65940`	Involved in valine catabolism.	Arabidopsis Chy1 null mutants are deficient in benzoic acid-containing glucosinolates in the seeds.2009 · DOI: 10.1111/j.1438-8677.2008.00160.x
`At2g30660`	Involved in valine catabolism.	No verified direct reference in this release
`At2g30650`	Involved in valine catabolism.	No verified direct reference in this release
`At4g31810`	Small ribosomal subunit protein mS47.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020942 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006574 L-valine catabolic process Biological Process

GO:0006635 fatty acid beta-oxidation Biological Process

GO:0009409 response to cold Biological Process

GO:0009733 response to auxin Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0009536 plastid Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003860 3-hydroxyisobutyryl-CoA hydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT1G06550

ath:AT2G30650

ath:AT2G30660

ath:AT4G31810

ath:AT5G65940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.622

Rank 1 · LXL04_020942 · OH-1004

Peroxisome0.198

Rank 2 · LXL04_020942 · OH-1004

Nucleus0.186

Rank 3 · LXL04_020942 · OH-1004

Mitochondrion0.122

Rank 4 · LXL04_020942 · OH-1004

Cell membrane0.056

Rank 5 · LXL04_020942 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00378.26ECH_114-256 aa

PF16113.11ECH_218-350 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_020942	`PF00378.26`	ECH_1	14	256	3.8e-30	105.8
LXL04_020942	`PF16113.11`	ECH_2	18	350	1.5e-112	377.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SHJ8`	Arabidopsis thaliana	3-hydroxyisobutyryl-CoA hydrolase-like protein 5	70.822%	Swiss-Prot	strong database homology
`Q9LKJ1`	Arabidopsis thaliana	3-hydroxyisobutyryl-CoA hydrolase 1	42.254%	Swiss-Prot	moderate database homology
`Q6NMB0`	Arabidopsis thaliana	Probable 3-hydroxyisobutyryl-CoA hydrolase 3	42.566%	Swiss-Prot	moderate database homology
`Q1PEY5`	Arabidopsis thaliana	Probable 3-hydroxyisobutyryl-CoA hydrolase 2	42.197%	Swiss-Prot	moderate database homology
`Q8RXN4`	Arabidopsis thaliana	Small ribosomal subunit protein mS47	42.373%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card