TkA05G313310 | RubberDandelionOmics

Gene overview

TkA05G313310

Reference: TK1151 Chr: Chr05 Coordinates: 77334512-77339623 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2124 bp · TkA05G313310|TK1151|cDNA

GAAACAAATCTAATCAGTTTGATAGATTACATAACCAGACTTTCTGATCTTTTTAACAATTAGGGGAGGGGTAAAATTGGAACTTCGGTGTCCCCAACGTGTTCATGGGATCGTAGCTGATCCGCAAGTTGATTGGAGTTTTGATGAACTTATATCAGAGCTTAATGCTGTTGACCAAAAACTTCAAACATCCTCATTGGTCCCTTTACCTTTCACCAAAACACATTCAAGTGACCTTTCAGTTGTAGGCCGTGCTGAAA...

CDS

Download CDS FASTA

1935 bp · TkA05G313310|TK1151|CDS

ATGGGAGGGGTAAAATTGGAACTTCGGTGTCCCCAACGTGTTCATGGGATCGTAGCTGATCCGCAAGTTGATTGGAGTTTTGATGAACTTATATCAGAGCTTAATGCTGTTGACCAAAAACTTCAAACATCCTCATTGGTCCCTTTACCTTTCACCAAAACACATTCAAGTGACCTTTCAGTTGTAGGCCGTGCTGAAAAAAACCGGAAGCCATTTGTGATGCATGTATCAGATGATGATGATGATGATGATGATGAGAA...

Protein

Download Protein FASTA

644 aa · TkA05G313310|TK1151|PROTEIN

MGGVKLELRCPQRVHGIVADPQVDWSFDELISELNAVDQKLQTSSLVPLPFTKTHSSDLSVVGRAEKNRKPFVMHVSDDDDDDDDENNSRQVAITGRFACDDIYLSDDEDSDSESDSDTGAQLSLMDKGGVIEGALIELSHEHQLTVAEEIRNRISAFGTDLTNEKEKLNHALFKAEKSKEARRELDRKRDLQYQRIIAEALDNHLTDVQRHHEYKSQIEEKKIRDDAAVEEAKRKQKALQEEKLRQEKMKSEEAKRQAE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G313310`
TK1151 ID	TkA05G313310
OH-1004 ID	LXL04_005228
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	93.900
Protein coverage (%)	TK1151 22.981 / OH-1004 35.071 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G313310

Location Chr05:77334512-77339623 (-)

Description Similar to RABA5D: Ras-related protein RABA5d

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13120`	Required for seed viability.	LONO1 encoding a nucleoporin is required for embryogenesis and seed viability in Arabidopsis.2012 · DOI: 10.1104/pp.112.202192

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005228 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0006887 exocytosis Biological Process

GO:0006914 autophagy Biological Process

GO:0009408 response to heat Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0034498 early endosome to Golgi transport Biological Process

GO:0048219 inter-Golgi cisterna vesicle-mediated transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

KEGG gene cross-reference

ath:AT1G05810

ath:AT2G31680

ath:AT2G43130

sce:YER031C

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.604

Rank 1 · TkA05G313310 · TK1151

Nucleus0.308

Rank 2 · TkA05G313310 · TK1151

Cell membrane0.077

Rank 3 · TkA05G313310 · TK1151

Golgi apparatus0.071

Rank 4 · TkA05G313310 · TK1151

Endoplasmic reticulum0.060

Rank 5 · TkA05G313310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28554DUF8437190-243 aa

PF28554DUF8437253-277 aa

PF07817GLE1324-555 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G313310	`PF28554`	DUF8437	190	243	0.67	10.7
TkA05G313310	`PF28554`	DUF8437	253	277	0.67	10.7
TkA05G313310	`PF07817`	GLE1	324	555	2.2e-43	149.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WPZ7`	Arabidopsis thaliana	sp\|Q0WPZ7\|GLE1_ARATH mRNA export factor GLE1	37.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card