LXL04_005228 | RubberDandelionOmics

Gene overview

LXL04_005228

Reference: OH-1004 Chr: Chr01 Coordinates: 158035254-158041263 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1269 bp · LXL04_005228|LXL04_005228|OH1004|cDNA

ATGTATTCGTTAATTCAATCTTCTTCTGATCTTAATTTCAAAGTCGTCATCATCGGAGACTCGGCGGTCGGCAAATCGAACCTGCTCTCTAGGTACGCTAGGAATGAGTTCAATATGCACTCTAAGGCCACCATCGGAGTCGAATTTCAGACGCAGACCATGGAGATCGACGACAAGGAGGTTAAGGCTAATTCGGCTTTAAATTCGGAGACGAGTGAGCATGTTGCGATTAAGAAGATTGCCAACGCCTTCGATAATAA...

CDS

Download CDS FASTA

1269 bp · LXL04_005228|LXL04_005228|OH1004|CDS

ATGTATTCGTTAATTCAATCTTCTTCTGATCTTAATTTCAAAGTCGTCATCATCGGAGACTCGGCGGTCGGCAAATCGAACCTGCTCTCTAGGTACGCTAGGAATGAGTTCAATATGCACTCTAAGGCCACCATCGGAGTCGAATTTCAGACGCAGACCATGGAGATCGACGACAAGGAGGTTAAGGCTAATTCGGCTTTAAATTCGGAGACGAGTGAGCATGTTGCGATTAAGAAGATTGCCAACGCCTTCGATAATAA...

Protein

Download Protein FASTA

422 aa · LXL04_005228|LXL04_005228|OH1004|PROTEIN

MYSLIQSSSDLNFKVVIIGDSAVGKSNLLSRYARNEFNMHSKATIGVEFQTQTMEIDDKEVKANSALNSETSEHVAIKKIANAFDNKIDAKRTLREIKLLRHMDHVNVSEYSFGYNSWEDVGRVKLELRCPQRVHGIVADPQVDWSFDELISELNAVDQKLQTSSLVPLPFTKTHSSDLSVVGRAEKNRKPFVLHVSDDDDDDDDEKNSRQVGMTGRFACDDIYLSDDEDSDSESDSDTGAQLSLMDKGGVIEGARIELS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005228`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005228

Location Chr01:158035254-158041263 (+)

Description Similar to RABA5D: Ras-related protein RABA5d

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g31680`	Intracellular vesicle trafficking and protein transport.	No verified direct reference in this release
`At1g05810`	Intracellular vesicle trafficking and protein transport.	No verified direct reference in this release
`At2g43130`	Intracellular vesicle trafficking and protein transport.	In vitro mutation analysis of Arabidopsis thaliana small GTP-binding proteins and detection of GAP-like activities in plant cells.1994 · DOI: 10.1016/0014-5793(94)80696-9

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0281700`	May play an important role in plant growth and development.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005228 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0006887 exocytosis Biological Process

GO:0006914 autophagy Biological Process

GO:0009408 response to heat Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0034498 early endosome to Golgi transport Biological Process

GO:0048219 inter-Golgi cisterna vesicle-mediated transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

KEGG gene cross-reference

ath:AT1G05810

ath:AT2G31680

ath:AT2G43130

sce:YER031C

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.477

Rank 1 · LXL04_005228 · OH-1004

Nucleus0.361

Rank 2 · LXL04_005228 · OH-1004

Cell membrane0.137

Rank 3 · LXL04_005228 · OH-1004

Mitochondrion0.075

Rank 4 · LXL04_005228 · OH-1004

Endoplasmic reticulum0.067

Rank 5 · LXL04_005228 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00071.29Ras14-63 aa

PF08477.20Roc14-60 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005228	`PF00071.29`	Ras	14	63	5.3e-14	52.8
LXL04_005228	`PF08477.20`	Roc	14	60	5.2e-11	43.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SIP0`	Arabidopsis thaliana	Ras-related protein RABA5d	90.196%	Swiss-Prot	weak database homology
`P19892`	Arabidopsis thaliana	Ras-related protein RABA5e	84.314%	Swiss-Prot	weak database homology
`P28187`	Arabidopsis thaliana	Ras-related protein RABA5c	86.275%	Swiss-Prot	weak database homology
`P25766`	Oryza sativa subsp. japonica	Ras-related protein RGP1	66.129%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card