Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3567 bp · TkA05G302020|TK1151|cDNA
CAGTGGGTGGGGTGACGCCCACTCAATCTCAAGTCTCACATGTCTCTTGCACCTCCAGCCACGCCTTTCCCGGCGGCCATGGTGGTGGATTTCCCACCAAAGAAGCTTCACTTTCCCGTTAAAGTTTCTCTTTTCCTCTTTTCCCACATTTTTTCACACCTTAACCCCTTCTTCTCCATGGAAAACGAAGGTCTATTCTCCTCTTTTATACAGAAAGACGTTCGTATTAAAAAACCCCATGTTCAATTCTTTATATAATT...
2049 bp · TkA05G302020|TK1151|CDS
ATGGTAAATTTTCATTTACAGACACTTAAGATTGGATTAATTTTGGTTTGGCTGTGTGGGTTTATCCTTATTTCAATTTCCTTCTATGCCACTACTCAAATATTGCCGTCTTCTTCTTCTTCCATTAAAGAGCAAATCAATAACCTCACTGGTTCAAAGAGGCCCACTGTTACAATATTTACAGCCGTTAGGCCTTTTAGCGGTTCAATTGGGAGAAAACAGAGTTTAGCAATTAGATCATGGCTTGGATTATCACAAGA...
Protein
Download Protein FASTA682 aa · TkA05G302020|TK1151|PROTEIN
MVNFHLQTLKIGLILVWLCGFILISISFYATTQILPSSSSSIKEQINNLTGSKRPTVTIFTAVRPFSGSIGRKQSLAIRSWLGLSQDIRVVLFTQDPSGFSFADSFGPGSRVAVEPTTDFTFLGTPFFHSMIARAQASNSDISVVMDSETILLPDFFSTLSYVHKLDHDWLLIASSKNISDFPFQLDVDGKHWVGYNGKRVATKKLQDFLSHGQWEDCVDKKMIMAWNTGDLPLHNGVLPPFLYGKGFHTLWVINEALSS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G302020 |
|---|---|
| TK1151 ID | TkA05G302020 |
| OH-1004 ID | LXL04_020749 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 92.800 |
| Protein coverage (%) | TK1151 99.413 / OH-1004 76.596Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G302020 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:74492298-74497040 (+) | |||||||||
| Description | Similar to RAY1: Beta-arabinofuranosyltransferase RAY1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0010265 SCF complex assembly Biological Process GO:0010306 rhamnogalacturonan II biosynthetic process Biological Process GO:0031506 cell wall glycoprotein biosynthetic process Biological Process GO:0042546 cell wall biogenesis Biological Process GO:0043687 post-translational protein modification Biological Process GO:0048868 pollen tube development Biological Process GO:0052325 cell wall pectin biosynthetic process Biological Process GO:0071555 cell wall organization Biological Process GO:0080147 root hair cell development Biological Process GO:0000138 Golgi trans cisterna Cellular Component GO:0000139 Golgi membrane Cellular Component GO:0005634 nucleus Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G56550 ath:AT1G70630 ath:AT2G35610 ath:AT4G01220 ddi:DDB_G0283005 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03407Nucleotid_trans433-653 aaPF20992CBP66_2nd460-484 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G302020 | PF03407 | Nucleotid_trans | 433 | 653 | 9.6e-47 | 160.4 |
| TkA05G302020 | PF20992 | CBP66_2nd | 460 | 484 | 0.24 | 12.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.