TkA05G300940 | RubberDandelionOmics

Gene overview

TkA05G300940

Reference: TK1151 Chr: Chr05 Coordinates: 74236755-74241951 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2573 bp · TkA05G300940|TK1151|cDNA

TATTCATTTGAATCATTTCACGTCATCATTTACATTCCCTAAACGGCTCCGTTCCTTGAAGCCAAACACGCCACTATTTACGTTGCTGAAACGTTTTCCATCCCATTCCACGTCACTAACAGATTAGCTGCCCGCCAGTCATTCGGCGACGATAACACCCCCAATCGGCAGCCATTTTTTTGGCGGCGAAAATCGAATCTACGAGCTTCGGTATCCGTTGATTTCTGCTTAATTTAATGAACAATGACTTTGATTCTTAA...

CDS

Download CDS FASTA

1476 bp · TkA05G300940|TK1151|CDS

ATGACTTTGATTCTTAATAATCATCATCATCCTAGCTTCATTTACTCCAATATTCATTCGAAAAAGTTCAATTTCACCACCAAATTAGGGGTAAAGTACTCTTGTCGTAGAGCTAACAGAAGACTTGTTTTTACGCCGGTGAATTCGGCATCCGTTAACGGATATTCAGTGCGGAATCATGATGATAGTCCACAAGTTTCAGATGGAGTGGGCACGGGTGACGGAGAAGATAATGTGGTTGGGCTGTCTGAGAGGTTGTT...

Protein

Download Protein FASTA

491 aa · TkA05G300940|TK1151|PROTEIN

MTLILNNHHHPSFIYSNIHSKKFNFTTKLGVKYSCRRANRRLVFTPVNSASVNGYSVRNHDDSPQVSDGVGTGDGEDNVVGLSERLLRFVRLVSSVLPGGNWWRFPEEVEISETAKPVTLVRALRRMWGLISHDRWVIFAAFSALILTALTEISIPHFLTASIFSAQSGNTAVFQGNVKLLIFLCITSGICSGLRGCWFGIANMILVKRMRETLYSVLLLQDINFFDSESIGDLTSRLGSDCQQVSRVIGNDLNLILRNL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G300940`
TK1151 ID	TkA05G300940
OH-1004 ID	LXL04_020745
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.200
Protein coverage (%)	TK1151 99.593 / OH-1004 71.409 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G300940

Location Chr05:74236755-74241951 (+)

Description Similar to ABCB26: ABC transporter B family member 26, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g70610`	ABC transporter B family member 26, chloroplastic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020745 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006518 peptide metabolic process Biological Process

GO:0010044 response to aluminum ion Biological Process

GO:0015031 protein transport Biological Process

GO:0015833 peptide transport Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0140982 detoxification of aluminum ion Biological Process

GO:1902602 aluminum ion transmembrane transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005764 lysosome Cellular Component

GO:0005765 lysosomal membrane Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G70610

dosa:Os03g0755100

hsa:23457

mmu:56325

rno:63886

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.952

Rank 1 · TkA05G300940 · TK1151

Mitochondrion0.043

Rank 2 · TkA05G300940 · TK1151

Peroxisome0.029

Rank 3 · TkA05G300940 · TK1151

Endoplasmic reticulum0.020

Rank 4 · TkA05G300940 · TK1151

Cell membrane0.018

Rank 5 · TkA05G300940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29060VTC5_C132-194 aa

PF00664ABC_membrane139-405 aa

PF29060VTC5_C266-293 aa

PF29060VTC5_C368-383 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G300940	`PF29060`	VTC5_C	132	194	0.079	13.7
TkA05G300940	`PF00664`	ABC_membrane	139	405	5.4e-38	132.0
TkA05G300940	`PF29060`	VTC5_C	266	293	0.079	13.7
TkA05G300940	`PF29060`	VTC5_C	368	383	0.079	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RY46`	Arabidopsis thaliana	sp\|Q8RY46\|AB26B_ARATH ABC transporter B family member 26, chloroplastic	65.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card